KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_141037Help
Entry
MYCFIDRAFT_141037 CDS       T03109                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pfj  Pseudocercospora fijiensis
Pathway
pfj00450  Selenocompound metabolism
pfj00970  Aminoacyl-tRNA biosynthesis
pfj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MYCFIDRAFT_141037
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MYCFIDRAFT_141037
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pfj01007]
    MYCFIDRAFT_141037
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pfj03016]
    MYCFIDRAFT_141037
Enzymes [BR:pfj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MYCFIDRAFT_141037
Amino acid related enzymes [BR:pfj01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MYCFIDRAFT_141037
Transfer RNA biogenesis [BR:pfj03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MYCFIDRAFT_141037
 Prokaryotic type
   Other AARSs
    MYCFIDRAFT_141037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 19331178
NCBI-ProteinID: XP_007929147
JGI: 141037
UniProt: M3ARM9
Position
Unknown
AA seq 577 aa AA seqDB search
MRISPHILPTRLTPLQSLIARRWRPQWICLHRLRVQQPWLRSLATSTTKSTDEKTYYVTT
PIFYVNAAPHVGHMYTMILADVLKRWQVLKGRRAVLLTGTDEHGLKIQRAAAKAGIDPQE
FCDSGADVFKELAEKMDMSNEIFIRTTDKKHKDGVEYAWQMLEERGWIYEGRHEGWYSVS
DETFYPQNQVQLVVDPPTGRKIMASIETGKEVEWTSERNYMFNLSAFRGQLLEFYEKNPD
YITPKSRMDDVVRQVKEGLEDLSISRPSERLQWGVQVPTDQSQTIYVWLDALLNYATAVG
YPFTPGQETAAGWPADVQVVGKDIVRFHCIYWPAFLMALDLPLHHQVLTHAHWTLGKQKM
AKSTGNGVNPFFALERFGIDPLRWYLIHEGGIADDADYDNSFIIEKYKKGLQGGLGNLAN
RVMRGQGWDVQRAVKRYSGESSPLQSELDTAAKDFYQRLLQLPPNVDEQMRSLLPNRALQ
TIMSGIFSANAFLQHASPWTIGEIDRSIYLAAETLRLTGIMLQPFMPTAAKKQLDFIGVA
EDRRTWDWCRVGADDTYGVSAVVLGKSGLFPKLTSDL
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatatcaccgcacatacttcctacgcgtctcacgcctcttcagtctctcatcgcg
cgtcggtggcggccccaatggatctgcctacatcgtctgcgcgttcaacagccatggctt
cgaagcctggctacgagcaccacaaagtcaacggatgagaaaacatactatgtgacgacg
ccaatcttctacgtcaacgccgctccccatgttggacacatgtataccatgattctggcc
gatgtcttgaaacggtggcaagtgctcaaaggccgacgcgcggtcctccttaccggcaca
gacgaacatggcctcaaaatccaacgcgccgctgcgaaagccgggatagatcctcaagaa
ttttgcgattcaggagcagacgtctttaaggaactggctgagaagatggacatgagtaat
gagatcttcattcggaccacggataaaaagcataaggatggtgtagagtacgcgtggcag
atgttggaggaaagaggatggatctacgagggcagacacgaggggtggtatagtgtcagt
gatgagacattctatccacaaaatcaggtccagttggtcgttgatcctccaaccgggagg
aagatcatggccagcatcgagactgggaaagaggtagagtggacgagtgagaggaattac
atgttcaatctgagcgcttttcgaggtcaattgctggaattttatgagaagaatccggac
tacatcacgcccaagagcaggatggatgatgttgtgaggcaggtcaaagaagggttggaa
gatctgtcgatatcacggccatcggagcgcttgcagtggggcgtgcaagtgcctacagat
caatcacaaacgatttatgtctggcttgatgcattgttgaactatgcgactgctgtcggg
taccctttcacacctggtcaggaaactgcagctggatggcctgcagatgtacaagttgtg
ggcaaggatatcgtgcgcttccattgcatttactggcctgcatttctcatggctctggat
ctgccactgcaccatcaagtcctcactcatgcacattggacacttggcaagcagaagatg
gcaaaaagcaccggcaatggagtcaatccattcttcgccctcgagcggtttggtatagat
cctctacgatggtaccttatacatgaaggcggcatcgcggatgatgcagattacgacaac
agcttcatcatcgagaagtacaagaagggcttgcaaggtgggctcggcaatcttgcgaac
agagtaatgcgaggtcaagggtgggacgtacagcgcgcggtgaagcgctacagtggagaa
tcctcgccactacagtcggaacttgacactgccgccaaggacttctaccaaagactgctg
cagctcccgccaaatgtcgatgagcagatgcgatcgcttctcccaaatcgagcactgcaa
acgatcatgagtgggatcttttcggccaacgctttccttcaacacgcctcgccttggacg
atcggcgagatcgaccgcagcatttacttggctgccgagacgctccgactcacagggata
atgctacagcccttcatgccaacggcagcaaagaagcagttggacttcatcggcgtcgct
gaagacaggcggacgtgggactggtgtcgcgtcggcgcggatgacacttatggcgtgtct
gctgtagtgcttgggaagagcgggttattcccgaagctcaccagcgacttgtag

DBGET integrated database retrieval system