KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_150500Help
Entry
MYCFIDRAFT_150500 CDS       T03109                                 

Definition
(RefSeq) hypothetical protein
  KO
K17498  transcription factor SPN1
Organism
pfj  Pseudocercospora fijiensis
Brite
KEGG Orthology (KO) [BR:pfj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pfj03021]
    MYCFIDRAFT_150500
Transcription machinery [BR:pfj03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     MYCFIDRAFT_150500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 19331508
NCBI-ProteinID: XP_007923029
JGI: 150500
UniProt: M2Z6L1
Position
Unknown
AA seq 489 aa AA seqDB search
MEDLAQPETPTIDSNEVEPQGNNDPRDPLRPDVEEENGAGGTPPMAAPYTDMETQEDDAA
PIGNGANGEESAARGEDEKLENGNPASTDEAGIENEDEESELEDLDEAEFEDFDPSALAI
PDKPQQVDESNVNLLGVHKRKRTAEEEAERERKKKKKEKKREKPSRKKRGGDDDFSGGEE
IDGKRVRKSKIGSDGQPIKSSRRERTPINEDDLTPEERRRRALERKMDDAVKTHRVSRRK
AAQDIEERADQEVNEMRARMAKACEEDNRDRNNGKIATHKLKILPEVVALMNRNTIQSQL
VDPDINILEAVRFMLEPADQDAALPNIQIQRELFKILTNLNIGKDALIASSIGKLVLFYT
KSSQAQPDIKRQAEHLVQSWTSTILGKKDSARGRPIETKQYDPVAAAQSQRGGASQADRA
AMLAEKRRKVLAQPGPTNRARVEGGVGTYTIAPVNNLSNAQGVSSRKLGANDETFRKIAA
RSAAKSGKR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaggacctggcgcaaccagagacgccaacaatcgacagcaacgaggtagagcctcag
ggcaacaatgaccctcgggatcctttgaggcccgacgtcgaggaggagaacggtgctgga
ggcacaccgcccatggccgcgccgtacacagacatggagacccaagaagatgatgctgca
ccgatcggaaatggcgccaacggagaagagagcgcagcacgtggcgaggacgagaagttg
gagaacggtaatccggccagcaccgatgaagcaggcatcgaaaacgaggacgaggagtca
gagctagaagatttggatgaagcagagttcgaagacttcgacccttccgctcttgctatt
ccagacaagccgcaacaggtcgacgaatcgaacgtgaatctactgggcgtgcacaagcgt
aagcgaacggcagaagaggaagctgagcgcgaacgcaagaagaaaaagaaggagaagaag
cgtgagaagcccagtcgtaagaagaggggcggcgacgacgacttttctggcggcgaggag
atcgatggcaagcgcgtgcgcaagagcaaaatcggatcagatgggcaaccgatcaagtca
agcaggagagagaggacgcctatcaacgaggacgatcttacaccagaggagcgccgccgt
cgtgctctggagcgcaagatggatgacgccgtcaagacacatcgcgtttcacggcgcaaa
gccgcgcaggatatcgaggagcgcgcagaccaggaagtcaatgagatgcgtgcccgtatg
gcgaaggcctgcgaagaggataatcgcgaccgcaacaacggcaagatcgcaactcacaag
ctgaagattctgcccgaagtcgtggcactcatgaatcgcaacaccattcagtctcagctc
gtcgatcccgatattaatatcctggaggctgttcgcttcatgcttgagccagcagatcag
gatgcagccttgccaaatatccaaatccagcgtgaactcttcaagattctcacgaacttg
aacattggtaaagacgctctgattgccagctcaattggcaagcttgtcctcttctacacc
aaatcctctcaagcccaaccagatatcaaacgccaggccgaacatttagtccagagctgg
acatccacgatcctcggcaagaaagacagtgctcgaggtcgtccgattgagaccaagcag
tacgatcctgtcgcagctgcacaatctcagcgcggcggagcttctcaagctgaccgtgct
gccatgttggcggaaaagagacgcaaggtcctcgcccagcctggtcctaccaaccgagca
cgagtggaaggaggcgtcggaacgtacacgatcgcgcctgtgaacaacttgagtaatgct
cagggcgtgtcttccagaaagctgggagctaacgacgagactttcagaaaaatcgcagcc
aggagtgcggccaagtcggggaagcgatag

DBGET integrated database retrieval system