KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_186832
Entry
MYCFIDRAFT_186832 CDS       T03109                                 

Definition
(RefSeq) hypothetical protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
pfj  Pseudocercospora fijiensis
Pathway
pfj00910  Nitrogen metabolism
pfj01100  Metabolic pathways
Module
pfj_M00531  Assimilatory nitrate reduction, nitrate => ammonia
pfj_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:pfj00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    MYCFIDRAFT_186832
Enzymes [BR:pfj01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     MYCFIDRAFT_186832
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Rieske_2 Pyr_redox Rieske Fer2_BFD NIR_SIR_ferr Rubredoxin_C Amino_oxidase
Other DBs
NCBI-GeneID: 19334877
NCBI-ProteinID: XP_007923902
JGI: 186832
UniProt: M3BBS2
Position
Unknown
AA seq 1122 aa
MANSERNDVEANLLPEKVEKMEVTGELPRPAARKRIVVVGLGMVGVAFIEKLLKLDVKRQ
EYAITVIGEESHLAYNRVGLTSYFQHREVENLYLNPASWYASMPEGSLSYHLNTVVTSID
TEVKTVETAKGDTVPYDILVLATGSNALLPKHTPGYDANGVFVYRTIDDLQNLIKFAAMK
KGTVGAVVGGGLLGLEAAKAMMDLEEFQTVKLIERNRWVLSRQLDGDAGGMVLEQVRQLG
LDVLLSKRVGKINTDDQNNVVGVTFEDGEQMDCSTICFAIGIKARDELARKSGIKCADRG
GGIIVSEDLATSAKDVYAIGECASWENQTFGLIAPGIEMADVLAFNLTQAKAHTPRKFKR
PDLSTKLKLLGVEVASFGDFFADRDGPRHLPVRRGAKKDVTLEQKDRVDSARALITDGPP
PPPVKALTYKDPFQQIYKKYLFTIDGKYLLGGVMIGDTSDYVKLVPMVKNQKPLEIPPSE
LIIGKKSGDDDADDLDDDTQICSCHNVIKGDVAKSVKDGTCKSIGDVKSCTKAGTGCGGC
MPLVQTIFNKTMQSMGQEVMNHLCPHFEYSRADLYNIAYVKKLTTFAEIMKEAGKDAEAA
GCEACKPAIASITASLYNKHVLDDNQRGLQDTNDRFLANIQRNGTFSVVPRVSGGEITAD
KLVVIGTVAKKYGLYCKITGGQRIDMFGAKKHDLPSIWQELIDGGLESGHAYAKSLRTVK
SCVGTTWCRFGIGDSVGMAVRLEERYKSIRSPHKMKGGVSGCVRECAEAQNKDFGLIATD
KGFNIFVGGNGGATPRHSELLAKDVPPDDVVPILDRYLMFYIRTADKLQRTARWIEKLPG
GIKYLQEVILQDKLGICAELEKQMNELVDTFFCEWTEVLKSPKKMEIFSQFGNTKESVDS
IEQVPERGQSRPAHWAKESAKEDFRGHQWTSLSWQPLARSDQFSDSPTGSSLAVKRGDTQ
LAIFKVKGRYYATQQMCPHKRAFVLSDGLIGEDVKNEKLWVSCPLHKRNYSMKGDDAGKC
GNDETVNIATFPVEARDDGMVYVKLPPVEELDGVLGTEKWKIRKEETEMKSEFDALDKKL
MMSSKKGRKGVQASHLTNGLGAEGKAQAILAGGERGSRGMDW
NT seq 3369 nt   +upstreamnt  +downstreamnt
atggccaacagcgagcggaacgacgtcgaggccaatttacttcctgagaaggttgagaag
atggaggtcactggggagctaccgcgacctgctgcgaggaagaggatagtggtggtggga
ttgggcatggtgggagtagcattcattgagaagcttctcaagctggatgtaaagaggcag
gaatatgcaatcacagtgattggcgaggagtcacatctggcatacaacagagtcggcttg
acgagctacttccagcacagagaagttgagaatctctacctcaacccagcgtcttggtat
gcatccatgccggagggatctctatcataccacctcaacaccgttgtgacatcgatcgat
accgaagtcaagacggtagagactgcgaaaggagacactgtcccgtatgacattctggtc
ctcgcaacaggatctaatgctctgctgccgaagcacacccctggctacgatgccaatgga
gtattcgtgtatcgaaccatcgatgatctacagaacctcatcaagttcgctgcgatgaag
aaaggcacagttggtgctgtagtcggtggaggtctgctcgggctggaggctgctaaagcc
atgatggatctggaagagttccagacggtgaagctcattgagcggaatagatgggtcttg
agcagacagttggacggcgatgctggaggcatggttctcgagcaagtgcgacagttggga
cttgacgtgctcctaagcaaaagagttggcaagatcaataccgacgatcagaataatgtc
gtgggcgtgacattcgaagacggtgaacaaatggactgcagcacgatatgttttgcgatt
ggcataaaagcaagagatgagctcgcgcgcaagtcaggcatcaaatgcgccgatcgaggc
ggcggtatcatagtcagcgaagacttggctacgtccgccaaagatgtctacgcgattgga
gagtgtgctagttgggagaaccagacatttggccttatcgcaccaggaattgagatggca
gacgttctcgccttcaatctgacacaagcgaaagcacatactcctcggaagttcaagcgc
cccgacctaagcaccaaactgaagcttcttggcgttgaggtcgccagcttcggagacttc
tttgcggatcgcgatggacccaggcatcttccggtcaggagaggagccaagaaggacgtg
acactagagcagaaagatcgcgttgactctgctagagctcttattacagatggaccacca
cctccgcctgtcaaggctttgacatataaggatccattccaacagatatacaagaagtac
ttgttcacgattgacggcaaatacctgctcggtggcgtgatgatcggtgataccagcgat
tatgtcaagctggtgcctatggtcaagaatcaaaagcctctcgaaatacctccttcagag
cttatcataggcaagaagtctggagatgacgacgctgacgaccttgacgacgacacccaa
atatgctcatgtcataacgtgatcaagggcgatgtggccaagagcgtcaaagatggaacc
tgcaaatctatcggcgacgtcaagtcatgtacgaaagctggtaccggatgtggaggttgt
atgcctcttgtccagaccatctttaacaagacgatgcagtctatgggccaagaagtcatg
aatcatctctgcccacactttgagtactctcgcgctgatctctacaacattgcctacgtc
aagaagctgacgacctttgcggaaataatgaaggaggccggcaaggatgcggaagcagca
ggatgcgaagcttgcaaaccagcaatcgcgtccatcacagcatctctatacaacaagcac
gtcctcgacgacaaccaaagaggactccaagataccaatgacagattcttggccaacatc
cagcggaatggcactttctccgtggtccctcgtgtgtcaggtggcgaaatcactgcagac
aagctggtcgtcattggcacagtagctaagaagtacggcctttactgcaagatcaccggt
ggtcaacgcatcgatatgtttggtgcaaaaaagcatgatctcccctccatctggcaggag
ctcatcgatggaggcctagaatctggccacgcctatgccaagagcttaagaacggtcaag
tcatgtgtaggcacaacatggtgtcgattcggaattggcgactccgttggaatggctgtc
aggctcgaagagcggtacaagagcatacgatcaccccacaagatgaaaggaggcgtatca
ggatgcgttcgcgagtgtgccgaagcacaaaacaaagatttcggtctcatcgccacagac
aaaggtttcaacattttcgtaggcggcaacggcggagcaacaccacgacatagcgaactc
ctcgccaaagacgtgccaccagacgacgtcgtccccatcctcgaccgctacctaatgttc
tacatccgcacagcagacaaactccaacgcacagcccggtggatcgagaagctccccgga
ggaatcaaataccttcaagaagtcatcctccaagacaaactcggaatctgcgccgaactc
gagaaacaaatgaacgagctcgtcgacacattcttctgcgaatggaccgaagtcctgaaa
tctcccaagaagatggaaatattctcacaattcgggaatacgaaggaaagcgtcgactcg
attgaacaagtcccggaaagaggacaatcccgtcccgcgcactgggctaaagagtctgcg
aaagaggatttcagaggccatcaatggacttctttgtcttggcaaccccttgctcgatcc
gatcaattctcggattccccgacgggaagtagtttggctgtgaagagaggcgatacacaa
ctcgcaatcttcaaagtcaagggtcggtactacgccacgcaacaaatgtgtccacataaa
cgtgcattcgtgctctccgatgggctgatcggtgaagatgtgaagaacgagaaactctgg
gtttcttgtcctcttcataagaggaattattcgatgaaaggcgatgatgcgggaaagtgc
gggaacgatgagactgtgaatattgcgacgttccctgtggaagcgagggatgatggaatg
gtttatgttaagctgccgcctgttgaggaacttgatggtgtgctggggacggagaagtgg
aagattaggaaggaggagacggagatgaagagtgagtttgacgcgctggataagaagttg
atgatgagctcgaagaaggggaggaagggagtacaggctagtcatttgaccaatggactt
ggagcggaggggaaggcgcaggcgattttggctggtggtgagagagggagtagagggatg
gattggtag

DBGET integrated database retrieval system