KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_198907Help
Entry
MYCFIDRAFT_198907 CDS       T03109                                 

Definition
(RefSeq) hypothetical protein
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
pfj  Pseudocercospora fijiensis
Pathway
pfj00061  Fatty acid biosynthesis
pfj00071  Fatty acid degradation
pfj01100  Metabolic pathways
pfj01212  Fatty acid metabolism
pfj04146  Peroxisome
Module
pfj_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pfj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MYCFIDRAFT_198907
   00071 Fatty acid degradation
    MYCFIDRAFT_198907
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    MYCFIDRAFT_198907
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pfj01004]
    MYCFIDRAFT_198907
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfj04147]
    MYCFIDRAFT_198907
Enzymes [BR:pfj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     MYCFIDRAFT_198907
Lipid biosynthesis proteins [BR:pfj01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   MYCFIDRAFT_198907
Exosome [BR:pfj04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   MYCFIDRAFT_198907
  Exosomal proteins of breast cancer cells
   MYCFIDRAFT_198907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C GA-like
Motif
Other DBs
NCBI-GeneID: 19335765
NCBI-ProteinID: XP_007929855
JGI: 198907
UniProt: M3ANH4
Position
Unknown
AA seq 714 aa AA seqDB search
MGDVMSRKDLKQMLPQPRMYKKPPFTVEVAGVKKVDGETIPRRNVKTKDELKTTPEPGVN
TIYDILKRSSEKYGNAKALGKRKLVKLHTENKKVKRMVDGKEQEVDKKWTYFELSPYEYM
SFAEYEQLALNVGCGFRALGMKAQDRVHIFAATHPYWLATAHGAQSQSMPIVTAYDTLGE
EGLKHSLQQTHAKAIFLDPHLLTKLIKPLNESKDIQHVVYNDDDSPTRQIDAAQTEEAVK
KLKEAHPHLTVHSFSEFIQLGKGNKVEPTPPKPEDLCCIMYTSGSTGAPKGVLLSHKNVV
AAIAGVDVIVGPYLGPGDGLLTYLPLAHILEFVFESACLYWGGSMGYGNPKTISDNSMRN
CRGDIAEFKPTILVGVPAVWETVKKGVQAKVAKLNPVSRNMFWGAMSAKSFMMHNSSYLP
LAGIGTSIVDNVVFKKVAEATGGKLRICMNGGGPVAKETQRFISMCIAPMISGYGLTETA
AMGALMDPLSWTDSALGEIPGSAEVKLVDFPDAGYFSTNNPPQGEIWIRGASVTSGYLDL
EKETKESFTDDGWFKTGDIGEFDSYGQLRIIDRKKNLVKTLNGEYIALEKLESVYRSCSV
VGNICVFAQQDKNKPVAIVVPAEPALKQLASDNGVQGHGLEDLCHNEKVNNAVLKAMQDA
GKRGGLSGIEIIEGVVLADEEWTPQNGLVTSAQKLNRKGITEKYQNEIKKAYGS
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacgtcatgagtcgcaaggacctcaagcagatgcttcctcaaccaaggatgtac
aagaagccgcccttcactgttgaggtcgcaggcgtgaagaaggtcgacggtgagacgata
ccacgacgaaacgtcaagaccaaggacgaactcaagacgacgcccgaaccaggcgtcaac
accatctacgacatcctcaagcgatcgagcgagaagtatggcaacgccaaggccctgggc
aagaggaagctcgtcaaactgcatacagagaacaagaaggtcaagaggatggtcgatggc
aaggagcaggaggtcgacaagaagtggacctactttgagctgtcgccatacgagtacatg
tcgtttgccgagtatgagcagctggcgctcaacgtcggctgcggtttccgcgcgctgggc
atgaaggcacaggatcgagtacacatcttcgcggcaacacatccatactggctcgccaca
gcacatggcgcccagagccagagcatgccgatcgtgacggcatatgatactctaggcgaa
gaaggcctgaagcactctctccagcaaacacacgccaaggccatcttcctcgatccccat
ctcctcacgaagctcatcaagccgctcaatgaatcgaaggacattcagcatgtcgtctac
aacgacgatgattctccaacccgacaaattgacgcagctcagactgaagaggcggtcaag
aagctcaaggaagctcacccacacctgactgtgcacagcttcagcgagttcatccaactc
ggcaaaggcaacaaggtcgagccgacaccacccaagccagaagatctctgctgcatcatg
tacacttcaggttcaactggtgcgccaaaaggcgtgcttctgtcgcacaagaatgtcgtt
gcagccattgctggcgtggatgtgatagtcggcccatacctcggcccaggcgatggtctg
ctcacctaccttccactcgcacatattctcgaattcgtcttcgaatcggcatgtctctac
tggggaggcagcatgggttatggaaacccaaagacgatctccgacaactcgatgcgcaac
tgcagaggtgacattgccgaattcaaaccaaccattcttgtcggcgtccctgccgtttgg
gagactgtcaagaagggcgttcaagccaaggtcgcgaagctcaatcctgtctccaggaac
atgttctggggagcgatgagcgcaaagagcttcatgatgcacaactcgagctatctaccc
ctcgctggcatcggaacgagcattgtggacaatgtcgtgttcaagaaagttgctgaagcc
actggtggaaaactgcgcatctgtatgaacggaggtggtcctgttgccaaggagacacaa
cgattcatctcgatgtgtatcgcaccaatgatctctggttatggtctgaccgagactgcc
gctatgggtgcgctgatggaccctctttcctggaccgactccgccctcggtgagattccc
ggttctgccgaagtcaagcttgtcgacttcccagatgccggctacttctccaccaacaac
cctcctcagggtgagatctggattcgtggagcctcggtcacctctggctatcttgatctg
gagaaggagaccaaggagtctttcacagatgatggctggttcaagactggcgacattggt
gagttcgacagctatggtcagctgcgtatcatcgatcgcaagaagaacttggtcaagact
ctcaatggcgagtacatcgctttggaaaaactcgagtccgtctaccgatcatgctccgtg
gtcggcaacatttgtgtgttcgcgcagcaggacaagaacaagccagtcgcaatcgtcgtc
ccagcagagccagcactgaagcagctcgccagcgacaacggcgtgcaaggccacggtctt
gaagatctctgtcacaacgagaaggtcaacaacgcagtgctcaaggctatgcaggacgcc
gggaagcggggcggtctttctggtatcgagatcattgagggtgttgtcctcgccgatgag
gaatggactcctcaaaacggtctcgtcacatcggctcagaagctcaacagaaaaggcatc
accgaaaagtaccaaaacgagatcaagaaggcgtacggatcgtag

DBGET integrated database retrieval system