KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_208458Help
Entry
MYCFIDRAFT_208458 CDS       T03109                                 

Definition
(RefSeq) glycoside hydrolase family 32 protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pfj  Pseudocercospora fijiensis
Pathway
pfj00052  Galactose metabolism
pfj00500  Starch and sucrose metabolism
pfj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MYCFIDRAFT_208458
   00500 Starch and sucrose metabolism
    MYCFIDRAFT_208458
Enzymes [BR:pfj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     MYCFIDRAFT_208458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 19336677
NCBI-ProteinID: XP_007929110
JGI: 208458
UniProt: M2ZLU0
Position
Unknown
AA seq 573 aa AA seqDB search
MWSSCSILAAAALLADQAAAQVSANARATYYAPGIPTDAPVPGSYNDYLRPRVHFTPPRY
FMNDPNGLHRGADALWHMYYQYNPLTPVAGNQHWGHATSEDLYTWENQKIALWPPNNYTY
VFSGSAVLDPNNTSGFFPHQDNGVVAIYTLAEYPGGVQGVQYQAIAYSRDDGYTFEAYEA
NPVLDINSTQFRDPYVIWHEPSAQWVMTVAYAAEFVIAIFTSPDLKQWTHASNFTKHGHL
GVQYECPNLLQMPMRGQEEPIWLLLISMNPGGPRGGSVSQYFPGHFNGTHFEPFDDAARF
TDFGKDNYAAQFFHGVPANEPQIALGWASNWEYTQLVPTGLLEHGQFRSAMTVPRAHTIA
NISARGYDLISEIHNISAVVDSELAYNSSLGNGTIMTYFGHVDSGAIYFETNITNLTSST
RQGTANFTISSSLSGEYIQGGIKVAGEPGIWIDRGHIRGFDNPYFSDKFSEEGTFVPATA
SWDMSVVVDRSIIEIFLNGAQAAGTLTFFPTAPLDTLAIYVGGIDETASSSVAVWALRDT
WAGQANANGTVVGNVTQLDVRQVRLTTLNADRI
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcgtcgtgtagtatactcgcagcagcagctctgctggctgatcaagcagccgct
caagtatcagcaaatgcccgcgcgacatactacgcacctggcattcccacagatgcacca
gtcccgggcagctacaatgactacttgcggcccagagtacacttcactccgccgcgatac
ttcatgaatgaccccaatggcctgcaccgaggcgcagatgcattatggcatatgtactat
cagtacaatcctttgacacccgtcgcgggcaatcagcactggggccacgcgacctccgag
gacctctatacgtgggagaaccaaaagatcgcgctctggccgccaaacaactacacgtac
gtcttctccggcagcgcggtgcttgacccaaacaatacctccggcttcttcccacaccag
gacaatggagtggtcgccatctacacgctcgccgagtatcccgggggcgtgcagggtgta
cagtaccaagccattgcctacagccgagacgatggctacactttcgaagcatatgaggcc
aacccagtcctggacatcaacagtacccagttccgcgatccgtacgtcatctggcacgag
ccctccgcccagtgggtcatgaccgttgcgtatgctgcagagtttgtcattgccatcttc
acgtctccagatctcaagcaatggactcacgcctccaatttcaccaaacatggccacctc
ggcgtgcagtatgaatgtccgaatcttctgcagatgcccatgcgtggccaagaagagcca
atctggctcctgctcatcagcatgaacccaggaggacctcgtggcggtagcgtctcgcag
tacttccccggccacttcaacggcacccatttcgagccattcgacgatgctgcccgattc
acagacttcggcaaagacaactacgcagcccaattcttccatggtgtcccagccaatgag
ccgcagattgcgcttggctgggcttcaaactgggaatatacccagctcgtgcccacaggc
ttgctagagcacggccaattccgttccgccatgacagtcccacgagcccacacaatcgcc
aacatttcggctcgtggctacgacctcatctccgaaatccacaacatctccgctgtcgtc
gactcggagctagcatacaactcatctctcggcaacggcacaatcatgacctacttcggc
cacgtagactcaggggccatctacttcgaaaccaacatcacgaacctcacctcatccact
cgccaaggaacagcaaatttcacaatctcctcttccctctctggcgaatacatccaaggc
ggaataaaagtcgccggagaacctggaatctggatcgatcgaggccatatccgtggcttc
gacaacccgtacttttccgacaagttctccgaggaaggcacttttgtcccggctaccgca
tcttgggacatgagtgttgtcgttgatcggtccattattgagatcttcttgaatggcgcc
caagctgccggcaccttgacattcttcccaaccgcaccgcttgacaccttggcgatatat
gtcggcggcatcgatgagacggccagtagctccgtcgctgtctgggctttgagggatact
tgggcgggccaagcgaatgccaatgggactgtggtgggtaacgttacgcaacttgacgtg
agacaagtgcgcttgaccacgctaaacgcggaccgtatctaa

DBGET integrated database retrieval system