KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_210972Help
Entry
MYCFIDRAFT_210972 CDS       T03109                                 

Definition
(RefSeq) hypothetical protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
pfj  Pseudocercospora fijiensis
Pathway
pfj00071  Fatty acid degradation
pfj00592  alpha-Linolenic acid metabolism
pfj01040  Biosynthesis of unsaturated fatty acids
pfj01100  Metabolic pathways
pfj01110  Biosynthesis of secondary metabolites
pfj01212  Fatty acid metabolism
pfj04146  Peroxisome
Module
pfj_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pfj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MYCFIDRAFT_210972
   00592 alpha-Linolenic acid metabolism
    MYCFIDRAFT_210972
   01040 Biosynthesis of unsaturated fatty acids
    MYCFIDRAFT_210972
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    MYCFIDRAFT_210972
Enzymes [BR:pfj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     MYCFIDRAFT_210972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 19337265
NCBI-ProteinID: XP_007925357
JGI: 210972
UniProt: M3AJN4
Position
Unknown
AA seq 711 aa AA seqDB search
MSQTAAPVPDWVRKLKPSGPQGTELLANERKQSSVNVEKLSQFMFGKEALERKEKVLKVL
QAEKVFNKDQDYFDGRVDKWEKALARAKRMNQIYTKYGWGDLDKRVAYDLISEPLPYALH
EGMYIVTIRGQGTPEQHKKYLVPAVAHEHIGCYAQTELGHGSNVRGLETTATWNEDDKTF
TIHSPHLTASKWWIGSLGRTANHACVMAQLIIKGRPYGPHPFIVPIRDLKTHKLLENVYA
GDIGPKFGYNTMDNGFLLFNNVKVPHDAMLAKFSAVDPKTSKYLKPASPALVYGTLTWVR
STIVLQSGSTLARGVTIATRYLAVRRQFQDRDAPAGQKGENQTLNYTMVQARLLPLLAAT
FALHFTGKSMMELYEANQSKMQSRPSNTDDSPSKRSAGPEEVNAGSDLLADLHGTSCGLK
SLCSTTAAEGLEVCRRAMGGHGYSAFSGVGSWYADYLPTVTWEGDNYMLTQQVARYLLKS
ARTVLKGNDPTNDTTEILHFYLKRQDTGAAFDVLGKDSDIVAAFAWRSAYFTFEALRARD
QEKKSWNSLLVAFYNLSRAHSQYLVVKNFYETIHSHSISSELDPETLGLMHKLFRLYSLN
TLVSESSEFFTSSACTVAQIRLARSKTVMQLLEEIRPHAVRLVDSWDFPDWQLNSSLGRY
DGKVYEDMFYRAAELNPLNKKIVDPYPNSPVLFREGGNGPYADILKSSPKL
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagaccgctgctcctgtgcccgattgggtccgcaaactaaagccctcaggtccc
cagggcaccgagctgctggcgaacgagcgcaaacaatcgagcgtcaatgtcgagaagctg
agtcagtttatgtttggaaaggaggctctcgagcggaaggagaaggtcttgaaggttcta
caagctgagaaggtcttcaacaaggaccaggactatttcgatggacgcgtcgacaagtgg
gagaaggctctcgccagagcgaagagaatgaaccagatctataccaagtatggttgggga
gaccttgacaagagagtggcctacgatttgatcagcgagccactgccttatgctttgcac
gagggcatgtacatcgtcaccatcagaggccagggaactccagaacagcacaaaaagtat
cttgtgcctgcagtggcacacgagcatatcggatgctacgctcagacagaactgggccac
ggatcaaatgtgcgaggccttgagacgactgccacctggaacgaggatgacaagactttc
acaattcactcgcctcatctcactgcttcaaaatggtggattggatcccttggacgaacg
gccaaccacgcttgcgtcatggcacagctcatcatcaagggtagaccgtatggaccacac
cctttcatcgtgcccattcgggatctgaagacacacaagctgcttgagaacgtttacgct
ggcgatattggccccaagttcggctacaacaccatggacaatggtttccttttgttcaac
aacgtcaaggtcccacatgatgccatgttggccaagttctctgctgtcgacccgaagacc
agcaagtacctcaagccagcttcaccggctctggtttacggtaccctcacttgggttcgc
agcaccatcgttcttcagtccggaagcactctcgctcgtggtgttaccatcgctacgaga
tacctggctgttcgtcgccaattccaggatcgcgatgcacctgcaggacagaaaggcgag
aaccagacactcaactacacaatggtccaagcaagattactgccacttctggctgccacc
ttcgcgcttcacttcactggcaagagcatgatggagctttacgaagcaaatcagagcaag
atgcaaagtagaccgtcaaatactgacgactcgccatcgaagcgcagtgctggtcctgag
gaagtcaatgcaggctcagatctcctcgccgatctccacggcacgtcatgtggattgaag
tctttgtgctccaccactgccgccgaaggccttgaggtctgccgcagagccatgggaggc
cacggatatagtgctttctctggcgttggcagctggtatgctgactacctgccaacggtc
acatgggagggtgacaactacatgttgacccagcaagtcgctcgatacctgcttaagtcc
gcaaggacagtgctgaagggcaacgaccctaccaacgacacaaccgagatcctgcacttt
tacctcaagcgccaggatacaggcgctgctttcgacgtcctcggcaaggacagtgatatt
gtcgctgcctttgcatggcgatcagcatacttcaccttcgaagcgctccgcgctcgtgac
caggaaaagaagtcttggaactctctgctcgttgcattctacaacctttctcgcgcacat
tcgcaataccttgtggtgaagaatttctacgagactattcactcgcactccatcagcagt
gaactcgatccagagacccttggcctgatgcacaagctcttccgtctgtactccctgaac
accctcgtgtcggagtctagcgagttctttaccagctccgcatgcacagtcgcacagatc
cgtctcgcaagatcgaagaccgtgatgcagttgctcgaggagatacgaccccacgctgtc
cgccttgttgactcttgggacttcccagattggcagctcaacagttctcttggaagatat
gacgggaaggtatacgaggacatgttctatcgcgctgcggagctgaacccattgaataag
aagattgtggatccatacccgaacagccctgtgctgttcagagagggcggtaatggtcct
tacgctgatatacttaagtcaagccccaagctttga

DBGET integrated database retrieval system