KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_211863Help
Entry
MYCFIDRAFT_211863 CDS       T03109                                 

Definition
(RefSeq) hypothetical protein
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
pfj  Pseudocercospora fijiensis
Pathway
pfj00730  Thiamine metabolism
pfj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    MYCFIDRAFT_211863
Enzymes [BR:pfj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     MYCFIDRAFT_211863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 DAO NAD_binding_8 Lycopene_cycl Pyr_redox_2 NAD_binding_9 FAD_binding_2 FAD_binding_3 Pyr_redox_3 FAD_oxidored HI0933_like
Motif
Other DBs
NCBI-GeneID: 19337528
NCBI-ProteinID: XP_007928692
JGI: 211863
UniProt: M2ZR20
Position
Unknown
AA seq 340 aa AA seqDB search
MSPPAMSFQEPATTSNANYTVQASKLAALPHHNALPVNGLTKTATIDDMAGRWSDFSFAP
IRESQVSRAMTRRYFADLDTYAESDVVIVGAGSCGLSTAYCLAKARPDLKIAIIEAGVAP
GGGAWLGGQLFSAMIMRKPADAFLRDVGVPYEDEGPDSAFVVVKHAALFTSTLLSKVLHF
PNVKLFNATAVEDLITRKNANGHIQLAGVVTNWTLVSMHHDDQSCMDPNTINAPVIVSTT
GHDGPFGAFSVKRLVSMGVIPTLGGMRGLDMNTAEDAIVKGTREIAPGLVVGGMELSEVD
GANRMGPTFGAMALSGVKAAEVVLEIFDQRKAECSDGGKY
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtctccgcccgccatgagcttccaagagcctgccacaaccagcaacgccaactacact
gttcaagcttcaaaactggctgccctgccacaccacaacgccctaccagtaaatggactc
accaagactgctaccatcgacgacatggctgggcgttggagcgacttctcgttcgctccc
attcgtgaaagccaggtcagccgtgccatgaccaggcgctactttgccgacctcgacacg
tacgcggaatccgacgttgtcattgtcggtgctggctcatgtggcctgtctactgcctac
tgcctggccaaggctcgtccagatctcaagattgcaatcatcgaggccggcgttgctcca
ggtggtggagcgtggctcggtggtcagctcttctccgccatgataatgcgcaagcccgct
gatgctttcctacgcgacgttggcgttccctacgaggacgaaggtccggactctgctttt
gttgtggtcaagcatgcagccctgttcacgagcacgctcttgtccaaggtgcttcacttt
ccaaacgtcaagcttttcaacgctaccgccgttgaggacttgatcactcgcaagaacgcc
aatggccacatccagcttgctggtgtcgtcaccaactggactcttgtcagcatgcaccac
gatgaccaatcttgcatggatccaaacacaatcaatgcgccagtcattgtctcgacgacc
ggacacgatggtccattcggagccttctccgtcaagcgcctggtctctatgggtgtcatc
ccaactctcggaggtatgcgtggtctcgatatgaacactgccgaggatgctatcgtaaag
ggcacccgtgagatcgcaccgggtctcgttgtcggaggcatggagctgtccgaagtcgac
ggagccaaccgcatggggcctacatttggcgctatggcactttctggtgtaaaggcagct
gaggtcgtccttgagatcttcgaccagcgcaaggctgagtgcagcgacggcggaaagtac
tag

DBGET integrated database retrieval system