KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_26731
Entry
MYCFIDRAFT_26731  CDS       T03109                                 

Gene name
ERG4
Definition
(RefSeq) ERG4/ERG24 ergosterol biosynthesis protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pfj  Pseudocercospora fijiensis
Pathway
pfj00100  Steroid biosynthesis
pfj01100  Metabolic pathways
pfj01110  Biosynthesis of secondary metabolites
Module
pfj_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:pfj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    MYCFIDRAFT_26731 (ERG4)
Enzymes [BR:pfj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     MYCFIDRAFT_26731 (ERG4)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 19338518
NCBI-ProteinID: XP_007919772
JGI: 26731
UniProt: N1QCY4
Position
Unknown
AA seq 522 aa
MPPKRSTRSTTSPSTVASTSASASASASASASAPAPASRHETEEPHGYEFGGPVGASLIS
FGLPIGCYAFAFLCNDVSGCPPPSLLTPSKLFSAPLLSNKPSWQHALDTLAAEVGWPGWT
GLINIEAILGTLFWYFLSLLLYVLLPAQEVEGTELRTGGRLKYRFNSFLSAVTVMIVCAA
GTWLRGPDFQVWTFINRNYIQLLTCNIIISYALATFVYAKSFQVKPGNQDKRELAAGGHS
GNLIYDWYIGRELNPRVELPFFGEIDIKSFMELRPGMLGWIMLNLAFMAKQYKSYGYVTD
SMLVVNFAQAFYVFDALYMEPAILTTIDLIQDGFGFMLAFGDLAWLPFVYSIPAKYLSVH
PVVLGPFYLVLILAIQAFGYYIFRAANSEKNRFRTDPNDPSVAHLEYIETKTGSRLLTTG
WWGTARHINYLGDWVMSWAYCLPTLAAGYKLTPTVLFEGTRLVTTDGMKGYAIPITYFYM
LYFAILLIHRERRDEAKCKRKYGADWDKYCEKVRWRIVPGIY
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgcctccgaagcgctctacacgatccacgacgtcgccctccaccgtagcgtctacgtct
gcgtctgcgtctgcatctgcatctgcatctgcgtctgcgcctgcgcctgcgtctagacat
gaaacagaagaaccccacggctatgaatttggaggccctgttggcgcgtcgttgatctct
tttggactgcccatcggctgctatgccttcgctttcctttgcaacgacgtctcgggctgt
ccaccaccttcgcttttgacacccagcaagctgttttctgcgccgttgctctctaacaag
ccttcgtggcagcatgcactcgatacgctggcagctgaagtcggatggccgggttggacc
ggcttaatcaatatcgaggccatcctcggcacgctgttctggtacttcctgtctctgctg
ctctatgttctgctcccagcgcaagaggttgaaggaacagagctcaggaccggtggcaga
ctgaagtatcgcttcaactctttcctgtctgccgtcaccgtcatgatcgtatgcgccgcc
ggtacttggctccgaggacctgatttccaggtttggacattcatcaaccgcaactatatc
cagctcctcacctgcaacatcataatctcctatgcgctggcgaccttcgtctacgccaaa
tcattccaggtcaagcctggcaatcaagacaagagagagctggcggctggcggtcacagt
ggaaacctcatatacgattggtacatcggacgcgagctcaatcctcgtgtggagcttccc
ttctttggcgagatcgacataaagagcttcatggagctgcgtcccggaatgctgggctgg
atcatgctcaacctggcgttcatggcaaagcagtacaagagctatggctatgtcacagat
tctatgctcgtggtcaacttcgcgcaagctttctacgtcttcgatgcactttacatggag
ccggcaattctcacaacaattgacctaatccaggatggatttggcttcatgttagctttt
ggcgacctcgcctggcttccattcgtctacagcataccagcgaaatatctcagtgtccat
ccagttgttcttggccccttctatttggtcctcattctcgctattcaagcctttggatac
tacatcttccgtgcagccaacagcgagaaaaatcgctttcgaacggatcctaacgaccca
agtgttgcccatctggagtatatcgagactaagaccggctcgaggctgctcacgaccgga
tggtggggcacagcgaggcacatcaactatcttggtgactgggtcatgagctgggcatac
tgcttacctacccttgcagcagggtataagctgactccaacagtcttgtttgaggggacg
agattggtaacaacggacggcatgaaaggctacgcgattcccatcacctacttctacatg
ctgtacttcgcaattttgctcatccatcgtgagcgcagggatgaagcaaagtgcaagcgg
aagtacggcgcagattgggacaagtactgtgagaaagtgaggtggaggatagtgccaggc
atatattag

DBGET integrated database retrieval system