KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_46000Help
Entry
MYCFIDRAFT_46000  CDS       T03109                                 

Definition
(RefSeq) glycoside hydrolase family 13 carbohydrate-binding module family 20 protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
pfj  Pseudocercospora fijiensis
Pathway
pfj00500  Starch and sucrose metabolism
pfj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYCFIDRAFT_46000
Enzymes [BR:pfj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MYCFIDRAFT_46000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase CBM_20 DUF1966
Motif
Other DBs
NCBI-GeneID: 19339674
NCBI-ProteinID: XP_007925812
JGI: 46000
UniProt: M2YZY4
Position
Unknown
AA seq 627 aa AA seqDB search
MRPFVLIPVLAGLTTALTSAQWRSQSIYQVITDRFALTNGSSTQACDWGNYCGGTWQGIT
NKLDYIQGMGFTAVWISPIVKNIANTPYGNPYHGYWAQDIYSLNSAFGTAAELKALSAAL
HARGMYLMVDVVTNHMAYNGAPANVKYNTFSPFNDQKYYHPYCPLEYGNTTSTQVCWMGD
TTVSLPDLRTEDTAVQNGFNQWITQLVANYSIDGLRLDSAMQVNQAFWPGFVKASGVYAV
GEVLDGNPTSFCTWQSYMPGALNYPNYFWLNRAFASTSATMTELANNIQWLNSTCTDVTL
LGNFLENHDNPRFPTITKDTGLTQNAIAFSILNDGIPIVYYGQEQGFNGAVDPYNREPLW
TSGYNTKSSLYTFIAKVNGARNLAIRKNPTYAATKSKVVYSDTKIMATLKQGLLSVFTDS
GSSGSGSAILTPAKTGFAGYTKYTDLLSCNVIQTDSSGNLAVTINYGAPRVFYKTSELSG
TDLCASTNNIDQSQSRAATTSTSSTILPGRVVDTPAASCAVSGNVSVPFYQNTTTSWGEI
LKIIGSIDELGKWNTSNAIRMSSAMYTTSNPIWNATVLIPSDTSFEYKFIKVGSSGGVTW
ESGSNRKYTVPPSCISMSAVNSTWQST
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgcggccttttgtattaataccagttcttgctggactcactaccgcactgacgtctgca
cagtggcggtcgcaatctatataccaagttatcacagaccgattcgctctcacaaatggc
tcatccacgcaagcctgcgattggggcaactactgtggaggaacatggcaagggatcacg
aataagctggactatatccaaggcatgggctttacagccgtatggataagtccaatcgtg
aagaacattgccaacacaccttatggaaatccttaccatggctactgggcacaagacata
tattcgctcaactccgcattcggtacagcggcagaactaaaagcgctttcagctgctctg
catgctagaggcatgtacctcatggttgatgtggtgaccaatcacatggcatacaatgga
gctccagcaaatgtgaagtacaacacgttcagcccattcaatgaccagaaatactaccat
ccatattgcccgctcgaatatggcaacaccaccagcacgcaggtttgctggatgggagac
accacggtctctctcccagatttgagaactgaagataccgctgtccagaacgggtttaac
caatggatcacacagctggtagccaactacagcatagacggtctacgtctcgacagcgcc
atgcaagtcaatcaggctttctggcctggcttcgtcaaggcaagtggagtttatgctgtc
ggtgaagtgctagacgggaacccgacttccttttgcacgtggcagagctacatgccaggt
gctctcaactatcctaactatttctggcttaaccgggcgttcgcatctacttcagcaacc
atgaccgaacttgcgaataacattcagtggctcaactcgacttgcaccgatgtcacgttg
ctcggcaactttctggaaaaccacgataatcctaggtttccaacaatcacaaaggacact
ggcttgacgcagaatgcaatcgcgttctcaatcttgaacgatggaattcctatcgtctac
tacggacaagagcaaggtttcaacggagcggtcgacccatacaaccgcgagccgctttgg
acttccggctacaacaccaagtcttcgctgtacaccttcattgccaaagtgaatggagcc
agaaaccttgctatccgcaagaatcctacgtatgctgcaacgaagtcgaaagtggtatac
tccgacacaaagatcatggccactctaaagcaaggacttctttctgtattcacggactct
ggcagctctggtagcggatctgcaatcctgacgccagccaaaaccgggtttgcaggctac
acgaaatacacagatctgcttagctgcaatgtgatccaaaccgattcgagcggaaatctt
gctgtaaccatcaactacggtgcacctagggttttctacaaaacttccgagctgtcgggt
acagatctttgtgcgtctaccaacaacattgatcagtcccaatctagggctgcgactaca
tcaaccagctctacgattttacccggccgggtcgtggatacacctgcggcatcctgcgca
gtctctggcaatgtatccgtgccattttaccaaaacacaaccacatcctggggcgagatc
ctcaagatcatcggctctatcgacgagcttgggaagtggaatacctccaacgccatcagg
atgtcttcagcaatgtatacgacctcgaatcccatttggaacgcgactgtccttatcccg
tctgacacatccttcgagtacaaattcatcaaagttggttcaagcggaggcgtaacttgg
gaatctggttccaatcgcaagtacacagtgccaccatcctgcatctcaatgtcggccgtg
aacagcacatggcagtcaacgtaa

DBGET integrated database retrieval system