KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_71448Help
Entry
MYCFIDRAFT_71448  CDS       T03109                                 

Definition
(RefSeq) hypothetical protein
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
pfj  Pseudocercospora fijiensis
Brite
Enzymes [BR:pfj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     MYCFIDRAFT_71448
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2
Motif
Other DBs
NCBI-GeneID: 19340987
NCBI-ProteinID: XP_007920326
JGI: 71448
UniProt: N1QB01
Position
Unknown
AA seq 303 aa AA seqDB search
MAKPQYLTGDKAGIDAFIDKFDTFLFDCDGVLWSGDHLFPNVPQTIDMLRKKGKQLVFVT
NNSTKSRSDYKKKFDKVGITASEQEVFGSSYSAAIYISRIMKLQAPRNKVFVLGESGVEQ
ELKSENIPYCGGTDPAYRRDMTDADFKGIADGSGLDPDVAVVLTGLDFHPSYYKYSLGFA
YVRKGARFLATNIDSTLPNAGSLYPGAGSMSAPLVSAVGNDPLSLGKPSQAMMDAVEGKF
QFDRKKACMIGDRLNTDIEFGIKGGLGGTLAVLTGVTKKEDFLAEGAPVVPSAYVDQLGD
LLG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagccgcagtacttgaccggcgacaaggctggtatcgatgccttcatagacaaa
ttcgacacgtttctctttgactgcgatggcgtgctttggtctggagatcatctcttcccc
aatgtgcctcagacgatcgatatgctgcgaaagaaaggcaagcagctcgtgttcgtgaca
aacaacagcacgaaatcacgcagcgactacaagaagaagtttgacaaagtcggaatcact
gcaagtgaacaagaagtcttcgggtcgagctacagcgcagcaatctacatttcacgcatc
atgaagctgcaagcaccgaggaacaaggtcttcgtccttggtgaatcgggcgtagagcaa
gaattgaagagcgagaatatcccgtactgcggcggcacagacccggcatatcgacgagac
atgacagatgccgacttcaagggcatcgctgatggctcagggcttgaccctgacgtcgcg
gtggtcctcactggcctcgactttcaccccagttattacaagtactccctcggatttgcg
tacgttcgcaaaggcgccaggttcctcgcaaccaacatcgactctacccttccaaacgcc
ggatcattgtaccctggtgcgggctctatgagcgctccgcttgtttcagcagtagggaat
gaccctctgtcactcggcaagccaagtcaagccatgatggatgctgttgagggcaagttc
caattcgatcgcaaaaaggcctgcatgattggcgaccgtctcaacaccgacattgaattt
ggcatcaagggcgggctgggaggcactcttgctgtgcttacaggtgtcaccaagaaagag
gatttcctagctgaaggcgctccagtcgtgccgagcgcgtacgtcgatcagcttggagat
cttcttggctaa

DBGET integrated database retrieval system