KEGG   Pseudomonas frederiksbergensis: PFAS1_06550Help
Entry
PFAS1_06550       CDS       T04786                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
pfk  Pseudomonas frederiksbergensis
Pathway
pfk00350  Tyrosine metabolism
pfk00643  Styrene degradation
pfk01100  Metabolic pathways
pfk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    PFAS1_06550
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    PFAS1_06550
Enzymes [BR:pfk01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     PFAS1_06550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 Tom37 GST_C
Motif
Other DBs
NCBI-ProteinID: APV39016
UniProt: A0A1P8ES28
Position
complement(1365949..1366584)
Genome map
AA seq 211 aa AA seqDB search
MELYTYYRSTSSFRVRIALALKGLDYQALPINLIAPPGGEHRQPPYLSINPQGRVPALRT
DEGELLIQSPAIIEYLEERYPQVPLLSKDLAARAHERGVAAVIGCDVHPLHNVSVLNKLR
QLGHDEPQVVEWIGHWISQGLATVEQLIGDEGYCFGPTPGLADVYLIPQLYAAERFSISL
EAYPRIRRVAALAATHPAFIEAHPANQPDTP
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggaactctatacctactaccgttcgacttcgtccttccgggtgcgcattgcgttggcg
ctcaagggcctggattaccaggcgttgccgatcaacctgatcgcgccgccaggtggtgaa
catcggcagccgccgtatctgagcatcaatccccaaggccgggtgccggccttgcgcacc
gacgaaggcgaactgctgatccagtcgccggcgatcatcgagtacctggaggaacgttat
ccacaggtgccgctgctctccaaagacctcgccgctcgcgcccatgagcgtggcgtggcg
gcagtgattggttgcgacgtgcacccgctgcacaacgtcagcgtgctcaacaagctgcgg
cagttgggccacgatgaaccgcaagtggtggagtggatcgggcactggatcagccaaggg
ctggcgacggtggagcagttgatcggcgacgagggttattgctttggtccgacacctggg
ctggcggatgtttacctgatcccgcagctgtacgcggccgagcgcttcagcatttcactt
gaagcgtatccgcggattcgtcgagtggcggcgttggcggcgacgcatccggcattcatc
gaggcgcatccggcgaaccagccggacaccccataa

DBGET integrated database retrieval system