KEGG   Pseudomonas frederiksbergensis: PFAS1_19120Help
Entry
PFAS1_19120       CDS       T04786                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
pfk  Pseudomonas frederiksbergensis
Pathway
pfk00360  Phenylalanine metabolism
pfk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pfk00790  Folate biosynthesis
pfk01100  Metabolic pathways
pfk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    PFAS1_19120
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PFAS1_19120
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PFAS1_19120
Enzymes [BR:pfk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     PFAS1_19120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: APV41366
UniProt: A0A1P8EYS6
Position
complement(4103167..4103952)
Genome map
AA seq 261 aa AA seqDB search
MKQTQYVAREPDAQGFIDYPAEEHAVWNTLITRQLKVIEGRACQEYLDGIEKLGLPHDRI
PQLGEINKVLGETTGWQVARVPALIPFQTFFELLANKQFPVATFIRTREELDYLQEPDIF
HEIFGHCPLLTNPWFAEFTHTYGKLGLQASKEERVYLARLYWMTIEFGLVDTAEGLRIYG
GGILSSPKETVYCLSDEPEHQAFDPLECMRTPYRIDILQPLYFVLPNLKRLFDLAHEDIM
GMVKQGMQLGLHTPKFPPKAA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagacgcaatacgtggctcgcgagcccgatgcgcaaggttttatcgactacccc
gccgaagaacacgcggtgtggaacacgctgatcactcgccaactgaaagtgatcgagggt
cgtgcgtgccaggaatacctggacggtatcgaaaaactcggtctgccccacgaccgcatt
ccgcaactcggcgagatcaacaaggtcctcggtgaaaccaccgggtggcaggttgcccgg
gtacccgcactgatccccttccagacctttttcgaattgctcgccaacaagcagtttccg
gtggcgacgtttattcgtacccgcgaagagctggattacctgcaagagccggacattttc
cacgagatctttggccactgcccgctgctgaccaatccttggtttgccgaattcacccac
acctacggcaaactcggcctacaggcttccaaggaagaacgcgtgtacctggcgcgcctg
tactggatgaccatcgagttcggcctggtcgatacagctgaaggcctgcgcatctacggc
ggcggcattctctcctcgccgaaagaaaccgtttactgcctgtcagacgaacctgagcat
caggccttcgatccgctggaatgcatgcgcacgccgtatcgcatcgacatcctgcaaccg
ctgtactttgtcctgccgaacctcaagcgtctgttcgacctcgcccacgaagacatcatg
ggcatggtcaagcaaggcatgcagttgggcttgcacacaccgaaatttccgccaaaggct
gcgtga

DBGET integrated database retrieval system