KEGG   Pseudomonas frederiksbergensis: PFAS1_20250Help
Entry
PFAS1_20250       CDS       T04786                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pfk  Pseudomonas frederiksbergensis
Pathway
pfk00071  Fatty acid degradation
pfk00072  Synthesis and degradation of ketone bodies
pfk00280  Valine, leucine and isoleucine degradation
pfk00310  Lysine degradation
pfk00362  Benzoate degradation
pfk00380  Tryptophan metabolism
pfk00620  Pyruvate metabolism
pfk00630  Glyoxylate and dicarboxylate metabolism
pfk00640  Propanoate metabolism
pfk00650  Butanoate metabolism
pfk00900  Terpenoid backbone biosynthesis
pfk01100  Metabolic pathways
pfk01110  Biosynthesis of secondary metabolites
pfk01120  Microbial metabolism in diverse environments
pfk01130  Biosynthesis of antibiotics
pfk01200  Carbon metabolism
pfk01212  Fatty acid metabolism
pfk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pfk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PFAS1_20250
   00630 Glyoxylate and dicarboxylate metabolism
    PFAS1_20250
   00640 Propanoate metabolism
    PFAS1_20250
   00650 Butanoate metabolism
    PFAS1_20250
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PFAS1_20250
   00072 Synthesis and degradation of ketone bodies
    PFAS1_20250
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PFAS1_20250
   00310 Lysine degradation
    PFAS1_20250
   00380 Tryptophan metabolism
    PFAS1_20250
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PFAS1_20250
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PFAS1_20250
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PFAS1_20250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfk04147]
    PFAS1_20250
Enzymes [BR:pfk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PFAS1_20250
Exosome [BR:pfk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PFAS1_20250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: APV41575
UniProt: A0A1P8EZD6
Position
4350710..4351915
Genome map
AA seq 401 aa AA seqDB search
MTQALIFDALRTPRGKGKANGALHSVKPVNLVAGLLTALQRRTSLDTSQVDDVVLGCVTP
VGDQGSDIAKAATQVADWDVSVAGLQINRFCASGLEAVNLGAMKVRSGFEDLVVVGGVES
MSRVPMGSDGGAWAHDPETSFHSHFAPQGVGADLIATLEGFSRQDVDAYALHSQQKAARA
RADGSFNKSLVPVQDQNGIILLDHDEFIRAGSTLEGLGQLKPSFEMIGQMGFDATALRVY
SHVERIDHVHTAGNSSGIVDGAALMLIGSEAKGRALGLQPRARIVATAVTSTDPTIMLTG
PAPATRKALAKAGLRVEDIDLFEVNEAFASVVLKFIKDMAIDPDKVNVNGGSIAMGHPLG
ATGCAILGTLLDELETRRLRYGLATLCVGGGMGIATIIERL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagctttgattttcgacgcgttacgcacgccccgcggcaaaggcaaggccaat
ggcgccttgcacagcgtcaaaccggtgaacctggtagccgggctgctcaccgcgctgcaa
cggcgcacctctctcgataccagtcaggtcgacgatgtggtgcttggttgcgtgacgccc
gtcggcgatcaaggctccgacattgccaaagccgcgacccaggtggcggattgggacgtc
agcgtggcgggtttgcagatcaaccgcttctgcgcttcggggttggaggcggtgaacctc
ggcgcaatgaaagtgcgttccggcttcgaagacctggtggtggtcggcggcgtcgagtcc
atgtcccgcgtgccgatgggcagcgatggtggcgcttgggcacacgacccggaaaccagt
tttcacagccatttcgcccctcaaggcgtgggcgctgacctgatcgccacgctggaaggc
ttcagccgtcaggacgtcgatgcctatgcgctgcactcccagcaaaaggctgcgcgggcg
agggccgacggttcgttcaacaaatcgttggtgccagtgcaggaccagaacggcatcatc
ctgctcgatcacgatgaattcattcgcgccggatcgaccctggaaggcttgggccagctc
aagcctagcttcgagatgatcgggcaaatgggcttcgatgccacggcacttcgggtctac
agccatgtcgagcggatcgaccacgttcacacggcgggtaacagttccgggatcgtcgat
ggcgccgcgctgatgctgatcggctccgaggccaagggccgcgcgctgggtttgcagccg
cgggcgcgaatcgtcgccaccgccgtcaccagcaccgacccgaccatcatgctcaccggc
cccgcgccggccacccgcaaggctctggccaaggccgggttgcgggtcgaagacatcgac
ctgttcgaggtcaacgaagcgtttgcctcggtggtgctgaaattcatcaaggacatggca
atcgatccggacaaggtcaacgtcaacggcggctccatcgccatgggccacccgctgggc
gccaccggctgcgcgatcctcggcacgctgctcgatgaactggaaacccggcgcctgcgc
tatggcctcgcgacgctgtgtgtcggcggcggcatgggcatcgccaccatcatcgaacgc
ctctga

DBGET integrated database retrieval system