KEGG   Pseudomonas frederiksbergensis: PFAS1_24020Help
Entry
PFAS1_24020       CDS       T04786                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pfk  Pseudomonas frederiksbergensis
Pathway
pfk00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pfk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PFAS1_24020
Enzymes [BR:pfk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PFAS1_24020
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PFAS1_24020
    1.1.1.-  
     PFAS1_24020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C UDPG_MGDP_dh_N DAO
Motif
Other DBs
NCBI-ProteinID: APV42237
UniProt: A0A1P8F191
Position
5106197..5107291
Genome map
AA seq 364 aa AA seqDB search
MSLSINPVRSMRAAVWHGRNDIRVEDVPLPIAPPAGWVQIRVQWCGICGSDLHEYVAGPV
FIPVDAPHPLTGIKGQCILGHEFCGEIVELGAGVQGFSVGEPVAADACQHCGTCYYCTHG
LYNICENLAFTGLMNNGAFAELVNVPANLLYKLPANFPAEAGALIEPLAVGMHAVKKAGS
LLGQNVVVVGAGTIGLCTIMCAKAAGAAQVIALEMSGARKAKALEVGATHVLDPNECDAL
AEVRRLTGGLGADVSFECIGNKHTAKLAIDLIRKAGKCVLVGIFEEPSEFNFFELVATEK
QVLGALAYNGEFADVIAFIADGRLNITPLVTGRIQLEQIVGQGFEELVNNKEHNVKIIVS
PARV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagcctttcaatcaatccggtacgcagcatgcgcgcagcggtctggcatggccgcaac
gatatccgtgtcgaagacgttccgctgccaatagcaccgcccgccggctgggtgcaaatc
cgtgtgcaatggtgcggaatttgtggctccgatttgcatgagtacgtggccgggccggtg
ttcataccggtcgacgcgccgcacccgctgaccgggatcaagggccagtgcattctcggt
catgagttttgcggtgagatcgtcgaactcggtgccggtgtccaggggtttagcgtcggc
gaaccggtggcggccgacgcctgccaacattgcggcacctgctactactgcacccatggg
ctgtacaacatctgcgagaacctggccttcaccgggttgatgaacaatggtgccttcgcc
gaactggtcaacgtgccggccaacctgctgtacaaattgccggcgaacttccctgctgaa
gccggggcactaatcgagccgctggcggtgggcatgcacgcggtgaaaaaagccgggagc
ctgctcgggcagaatgtggtggtggtcggtgcaggcaccattggcttatgcaccatcatg
tgcgccaaggctgccggtgcggctcaggtgatcgctctggaaatgtctggagcgcgcaag
gccaaggctctggaagtgggggcgacccatgtgctcgatcccaatgagtgcgatgccttg
gccgaggtacggcgcctgacgggtgggctcggggcggatgtcagcttcgaatgcatcggc
aacaaacacacggccaagctcgcgatcgatctgatccgcaaggccggcaagtgcgtattg
gtggggatctttgaggagcccagcgagttcaacttcttcgagttggtggctaccgaaaaa
caggtactcggtgcgctggcctataacggtgaattcgctgacgtgatcgcttttattgct
gatggccggctgaacatcacaccactggtgaccgggcgcattcagttggaacagatcgtg
ggtcagggcttcgaggagctggtcaacaacaaggagcacaacgtcaaaatcatcgtgtca
cccgctcgagtctga

DBGET integrated database retrieval system