KEGG   Pseudomonas frederiksbergensis: PFAS1_25450Help
Entry
PFAS1_25450       CDS       T04786                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
pfk  Pseudomonas frederiksbergensis
Pathway
pfk00040  Pentose and glucuronate interconversions
pfk00053  Ascorbate and aldarate metabolism
pfk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PFAS1_25450
   00053 Ascorbate and aldarate metabolism
    PFAS1_25450
Enzymes [BR:pfk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     PFAS1_25450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: APV42489
UniProt: A0A1P8F1Z0
Position
5411640..5413220
Genome map
AA seq 526 aa AA seqDB search
MTRILGHNYIGGQRSAAGQLKLQSVDASTGEALPYDFSQATPEEVDAAAKAAAAAYPAYR
SLSAERRAQFLDAIADELDALGDDFVALVCRETALPAARIQGERGRTSGQMRLFAKVLRR
GDFYGARIDLALPERKPLPRPDLRQYRIGLGPVAVFGASNFPLAFSTAGGDTASALAAGC
PVVFKAHSGHMATAEQVADAIIRAAEKTDMPAGVFNMIYGGGVGEALVKHSAILAVGFTG
SLKGGRALCDMAAARAQPIPVFAEMSSINPVIVLPQALQTRAESIARDLTASVVQGCGQF
CTNPGLVIGIRSPQFTTFVQQVAGLVGDQPAQTMLNAGTLSSYGKGLQKLLAHPGIEHLA
GSPQQGNQAQPQLFKADVSLLIKGDEVLQEEVFGPTTVFVEVADQAQLSAALNGLHGQLT
ATIIGESADFEQFSELTPLLEQKVGRILLNGYPTGVEVCDSMVHGGPYPATSDARGTSVG
TLAIDRFLRPVCFQNYPDSLLPEALKNGNPLRIQRLVDGQPSREAL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgacccgaattcttggtcacaactacatcggcggtcagcgcagtgcggccggccagctc
aaactacagagcgtcgacgccagcacgggcgaagccctgccgtacgatttctcccaggcg
acgccggaagaagtcgatgccgccgccaaggctgccgccgcggcttacccggcctatcgc
agcctgagcgccgaacgtcgggcgcaatttctcgacgcgattgccgatgaactggacgcg
ctgggcgatgactttgtggcgctggtctgccgcgaaaccgcgctgcctgcggcacggatt
caaggcgaacgcggtcgcaccagcggccagatgcgtctgttcgccaaagtgctgcgtcgc
ggtgatttctacggggcgcggatcgatctggcgttgccagagcgcaagcccttgccgcgt
ccggatctgcgtcagtaccgcatcggcctcgggccggtggccgtgtttggcgccagtaac
tttccgttggcgttctccacagctggcggcgacaccgcatcggcattggccgccggatgc
ccggtggtgttcaaggcccacagcggtcacatggccacggccgaacaggtggccgacgcg
atcatccgcgccgccgagaaaaccgatatgccggccggcgtgttcaacatgatctacggc
ggtggcgtcggcgaagcgctggtcaagcattcggcaattctggcggttggttttaccggc
tcgctcaagggcggccgtgcattgtgtgacatggccgcagcacgggcgcagcccatcccg
gtgttcgccgaaatgtcgagcatcaacccggtgatagtgttgccgcaggcgctgcaaact
cgcgccgaatcgatcgcccgggacctgaccgcttcggtggttcagggctgtggtcagttc
tgcaccaatcccggtttggtcatcggtattcgttcgccgcaattcaccacattcgtgcaa
caggtggcggggctggtgggcgatcaaccggcgcaaaccatgctcaatgccgggaccttg
agcagctatggcaaaggcctgcaaaaactcctcgcgcatccgggcatcgagcatctggcc
ggaagtccgcagcaaggcaatcaggcgcaaccgcagctgttcaaggccgatgtcagcctg
ttgatcaagggcgacgaagtgctgcaggaagaagtgttcggcccgaccacggtgttcgtc
gaggtcgccgatcaggcgcaactcagcgccgcgttgaacggcctgcacgggcaactgacg
gcgacgattattggcgaatcggccgacttcgaacagttcagcgagctgacgccgttgctg
gaacagaaggtcgggcggatcctgctcaacggctatccgaccggcgtggaagtctgcgat
tcgatggtccacggcgggccgtatccggcgacctccgatgcacggggcacctcggtgggt
acgctggcgatcgaccgtttcctgcgcccggtgtgcttccagaactatccggacagcctg
ctgccggaggccttgaagaatggtaatccgctgcgtattcagcggttggtggatggccag
ccttcgcgcgaagccctctaa

DBGET integrated database retrieval system