KEGG   Pseudomonas protegens Pf-5: PFL_0112Help
Entry
PFL_0112          CDS       T00249                                 

Definition
(GenBank) succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00020  Citrate cycle (TCA cycle)
pfl00620  Pyruvate metabolism
pfl00650  Butanoate metabolism
pfl01100  Metabolic pathways
pfl01110  Biosynthesis of secondary metabolites
pfl01120  Microbial metabolism in diverse environments
pfl01130  Biosynthesis of antibiotics
pfl01200  Carbon metabolism
Module
pfl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PFL_0112
   00620 Pyruvate metabolism
    PFL_0112
   00650 Butanoate metabolism
    PFL_0112
Enzymes [BR:pfl01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     PFL_0112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans LUD_dom
Motif
Other DBs
NCBI-ProteinID: AAY95529
UniProt: Q4KKG9
Position
complement(113669..115162)
Genome map
AA seq 497 aa AA seqDB search
MYRDRIRLPSLLDKVMSAADAAALIEDGMTVGMSGFTRAGEAKAVPHALAERAKVTPLKI
SLMTGASLGNDLDKQLTEAGVLARRMPFQVDSTLRKAINAGEVMFIDQHLSETVEQLRNQ
QLKLPDIAVIEAVAITEQGHIVPTTSVGNSASFAIFAKQVIVEINLAHNPNLEGLHDIYI
PTYRPTRTPIPLVKVDDRIGSTAIPIPADKIVAIVITNQSDSPSTVSTPDSETQGIANHL
IDFLKQEVDAGRMSNKLGPLQAGIGNIANAVMCGLIESPFENLTMYSEVLQDSTFDLIDA
GKLSFASGSSITLSSRRNADVFGNLERYKDKLVLRPQEISNHPEVVRRLGIIGINTALEF
DIYGNVNSTHVCGTRMMNGIGGSGDFARNAHLAIFVTKSIAKGGAISSVVPMVSHVDHTE
HDVDILVTEIGLADLRGLAPRERARVIIDNCVHPSYRDALNDYFTKACALGGHTPHILRD
ALSWHINLEETGKMLVE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgtgatcgtatccgcttgccttcgttgttggataaggtgatgagcgccgctgac
gctgccgctctgattgaggacggcatgaccgtcggcatgagcggcttcacccgcgccggt
gaagccaaggccgtgccccatgccctggccgaacgggccaaggtaacgccactgaaaatc
agcctgatgaccggcgccagcctgggcaacgacctggacaagcagctcaccgaagctggc
gtgctggcccggcgcatgccgttccaggtggacagcaccctgcgcaaggcgatcaacgcc
ggcgaagtgatgttcatcgaccagcacctgtcggaaaccgtcgaacaacttcgtaaccag
cagctcaagctgccggacattgcagtgatcgaagctgtcgccatcactgaacagggccat
atcgtgccgaccacctcggtgggcaactccgccagcttcgcgatcttcgccaagcaggtg
atcgtcgagatcaacctggcgcacaacccgaacctggaaggcctgcacgacatctatatc
ccgacctatcgcccgacccgtacaccgattcccctggtgaaggtcgacgatcgcatcggc
agcacggcgattccgatccctgcggacaagatcgtcgccatcgtcatcactaatcagtcg
gattcgccgtccacggtttccaccccggacagcgagacccagggcatcgccaaccacctg
atcgactttctcaagcaggaagtggatgccgggcgcatgagcaacaagctcggcccgctg
caggccggtatcggcaacatcgccaacgcggtgatgtgcggcctgatcgagtcgccattc
gagaacctgaccatgtactccgaagtactgcaggactcaaccttcgacctaatcgacgcc
ggtaagctcagcttcgcctcaggtagctccatcaccctgtcgagccgacgcaacgccgac
gtgttcggcaacctggaacgctacaaggacaagctggtgctacgtccgcaggagatctcc
aaccacccggaagtggtgcgccgcctgggtatcatcggcatcaacaccgcgctggagttc
gatatctacggcaacgtcaactccacccacgtctgcggcacgcggatgatgaacggcatc
ggcggctccggcgacttcgcccgcaacgcacacctggcgatcttcgtcaccaagtcgatc
gccaagggcggggcgatttccagcgtggtgccgatggtcagccacgtggaccacaccgag
catgacgtcgacatcctggtgaccgagatcggcctggcggacctgcgcggcctggcgccg
cgggagcgggcccgggtgatcatcgacaactgtgtgcatccttcctaccgcgacgcactg
aatgactacttcaccaaggcctgcgccctgggtggtcacacgccgcatatcctgcgtgat
gcgctgagctggcacatcaacctggaagaaaccgggaaaatgctcgtcgagtga

DBGET integrated database retrieval system