KEGG   Pseudomonas protegens Pf-5: PFL_0753Help
Entry
PFL_0753          CDS       T00249                                 

Gene name
kynA
Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00380  Tryptophan metabolism
pfl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    PFL_0753 (kynA)
Enzymes [BR:pfl01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     PFL_0753 (kynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase TPR_14 YfdX
Motif
Other DBs
NCBI-ProteinID: AAY96155
UniProt: Q4KIP3
Position
877522..878373
Genome map
AA seq 283 aa AA seqDB search
MSQCPFSSNPPAEWHNAELNFSDSMSYGDYLDLGRILSAQHPLSPDHNEMLFIIQHQTSE
LWMKLMLHELKAAREHVRQGQLPPAFKMLARVSRIFDQLVHAWAVLATMTPSEYKSIRPY
LGQSSGFQSFQYREIEFILGNKSAALLRPHAHRPELLQSLEASIATPSMYDEAIALMARS
GLSIDPARLALDSTTTTQHDPSVEAAWREVYANPSAYWDLYQLAEKFIDLEDSFRQWRFR
HVTTVERIIGFQPGTGGTEGVGYLRKMLDTVLFPELWRVRSSL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagccaatgtcccttttcaagcaatccgccggctgagtggcataacgccgagctgaat
ttttccgactccatgagctacggcgactacctggacctggggcgcatcctcagcgcccag
catcccctgtcgccggaccacaacgagatgctcttcatcatccagcaccagacctcggag
ctatggatgaagctgatgctgcacgagctcaaggcggcccgcgagcatgtgcgccagggc
cagttgccgccggcgttcaagatgctggcgcgggtttcgcggattttcgatcaactggtg
cacgcctgggcggtgctggccaccatgacgccgtccgagtacaagtcgatccggccttac
ctgggccagtcctcgggcttccagtcgttccagtatcgggagatcgaattcatcctcggc
aacaagagcgcggccctgctgcggccccatgcccatcgtcccgaactgttgcaatcgctg
gaagcgtcgattgccaccccgtccatgtatgacgaggcgattgccctgatggcccgcagc
ggcttgagcatcgaccctgcgcgcctggcactggacagcaccaccacgactcagcatgac
ccgtcggtggaagcggcctggcgcgaggtctacgccaacccttcggcctattgggacctg
taccagttggcggagaagttcatcgacctggaagactccttccgccagtggcgctttcgc
catgtgactacggtggagcgcatcatcggcttccagcccggtaccggtggtaccgagggc
gtgggctacctgcgcaagatgctcgacaccgtgctgtttcccgaactgtggcgagtgcgc
tcctcgctctga

DBGET integrated database retrieval system