KEGG   Pseudomonas protegens Pf-5: PFL_1361Help
Entry
PFL_1361          CDS       T00249                                 

Definition
(GenBank) amidase family protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00970  Aminoacyl-tRNA biosynthesis
pfl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PFL_1361
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pfl03029]
    PFL_1361
Enzymes [BR:pfl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PFL_1361
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PFL_1361
Mitochondrial biogenesis [BR:pfl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PFL_1361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AAY90646
UniProt: Q4KGZ3
Position
1538955..1540313
Genome map
AA seq 452 aa AA seqDB search
MPPDSLNDATAMAQAFASGRTDPVQVLEQALALAEATPHVFISLCPARARREAEAAAARW
RAGQPLSLLDGVPLAWKDLFDLAGSITTAAAQVRREAPLAKVDAPSVRQLCRAGLVSLGK
TNLSEFAYSGLGLNPHFGTPINPHSDAQPRIPGGSSAGSAVAVAAGIVPIAMGTDTAGSI
RIPAAFNGLVGYRATSLRYDREGVFPLAESLDSLGPLTRSVRDAWLIDELLRGGDPRQLP
PPRSLAGQRFWVDSQVLDDSRTQAAVRANLLVVIESLQQAGALVEQRPLHSLQATLQLIQ
EQGWLGAAEAFALHQPLLDSEYAEQLDPRVRRRLESARQMPASQLLRLYQARRQLQQQVQ
DELDGAVLITPTVAHVAPPLAPLEQDEELFARTNLATLRLTMPGSFLDMPGVALPSGRDA
QGLPTGLLLSLPQGHDRQLLDAALALEAALPR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgccccctgattcgctgaacgacgccacggccatggcgcaagcctttgcctcgggccgc
accgatccggtccaggttctggagcaggccctggcgttggccgaggcaacgccccatgtg
ttcatttccctgtgcccggcccgggcccggcgcgaggctgaggcggcggctgcccgctgg
cgggccggccagccgctgagcctgctggatggcgtgcccctggcctggaaggacctgttc
gacctggccggcagtatcaccaccgccgccgcccaggtgcgtcgcgaggcgccgttggcc
aaggtggatgcgcccagcgtacggcagctgtgccgggccgggctggtcagcctgggcaag
accaacctcagtgagttcgcctattccgggctcggcctgaacccgcacttcggcactccg
atcaacccccacagtgatgcccagccacggattcccggtggttcctcggcaggttccgcg
gtggcggtggcggccggtatcgtgccgatcgccatgggcaccgacactgccggttcgatc
cgcattcccgcagccttcaatggcctggtgggttaccgcgccacctccctgcgctatgac
cgcgagggggtgtttcccctggccgaaagcctcgacagcctcgggccgctgacccgcagc
gtgcgcgatgcctggctgatcgacgagctgttgcgcggtggcgacccccggcaattgccg
ccgccccgcagcctggcggggcaacgcttctgggtcgattcgcaagtgcttgacgacagc
cgtacccaggccgccgtgcgggccaatctgctggtggtcatcgaaagcctgcaacaggcc
ggggcgctggtggagcaacggccgctgcacagcctgcaagccaccctgcaactgatccag
gaacaaggctggctcggcgccgccgaagccttcgccctgcaccagccgttgctcgacagc
gagtacgccgaacagctcgatccgcgggtgcgacggcgcctggaaagcgcccggcagatg
cccgccagccagttgctgcggctgtaccaggcgcggcgccagttgcagcaacaggtgcag
gacgaactggacggcgcggtgctgatcacccccaccgtggcccatgtggcgccgcccctg
gcgcccctggagcaggacgaagagctctttgcccggaccaacctggcgaccctgcgcctg
accatgcccggcagtttcctcgacatgcccggcgtggccctgcccagcggccgcgatgcc
cagggcttgcccaccgggctgttgctgagcctgccccagggccatgaccggcaactgctg
gatgcggccctggcgctggaggcggcgttgccgcgctag

DBGET integrated database retrieval system