KEGG   Pseudomonas protegens Pf-5: PFL_1719Help
Entry
PFL_1719          CDS       T00249                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00020  Citrate cycle (TCA cycle)
pfl00310  Lysine degradation
pfl01100  Metabolic pathways
pfl01110  Biosynthesis of secondary metabolites
pfl01120  Microbial metabolism in diverse environments
pfl01130  Biosynthesis of antibiotics
pfl01200  Carbon metabolism
Module
pfl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PFL_1719 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PFL_1719 (sucB)
Enzymes [BR:pfl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PFL_1719 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AAY91014
UniProt: Q4KFY8
Position
1924726..1925949
Genome map
AA seq 407 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKQPGDAVKRDELIVDIETDKVVLEVLATADGVLGAIV
KNEGDTVLSDEVLGSIVEGGAAAAAPAAAAAPAAAAAAPAAADGEDDPIAAPAARKLAEE
NGINIASVAGTGKGGRVTKEDVVAAVAAKKAAPAAAPAKAPAPAAGAPVFAAGDRVEKRV
PMTRLRAKVAERLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKSHNGVRLGFMSFF
VKAATEALKRFPAVNASIDGSDIVYHGYADIGVAVSSDRGLVVPVLRNAELMSLAEIEGG
IATFGKKARDGKLSMEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNILQRPMAI
NGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLDI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagcccccactttcccggaatcggttgccgatggcaccgttgcc
acctggcacaagcaaccgggcgacgccgtcaagcgtgacgagctgatcgttgacatcgag
accgacaaggtcgtgttggaagttctggccaccgctgacggcgtgctgggcgctatcgtc
aagaacgaaggcgacaccgttctgtccgacgaagtcctgggctccatcgttgaaggcggc
gctgctgccgctgctcctgctgccgccgccgctccggccgccgccgctgctgccccggct
gctgccgatggcgaagacgatccaatcgctgctcctgccgcgcgcaagctggctgaagaa
aacggtatcaacatcgcttccgttgccggtaccggcaaaggcggccgtgtgaccaaggaa
gacgtggtcgctgctgttgccgcgaagaaagccgctccggctgccgcgcctgccaaggct
ccggctcctgccgctggtgctccggtcttcgctgccggtgatcgcgtcgagaagcgcgtg
cctatgacccgcctgcgtgccaaggttgccgagcgtctggttgaagcccagtcgaacatg
gcgatgctgaccaccttcaacgaagtcgacatgactgaagtcatggccctgcgttcgaag
tacaaggacctgttcgagaagtcccacaatggcgtacgcctgggcttcatgtcgttcttc
gtcaaggccgccaccgaagccctgaagcgcttcccggctgtcaacgcctcgatcgacggt
tccgacatcgtctaccacggctatgccgacatcggtgttgcggtctccagcgaccgtggc
ctggtggttccggttctgcgtaacgccgaactgatgagcctggccgaaatcgaaggcggc
atcgccaccttcggcaagaaggcccgtgacggcaagctgtcgatggaagagatgaccggt
ggtactttcaccatcaccaacggtggtactttcggttcgatgatgtctaccccgatcgtc
aacccgccacaagccgcgatcctgggcatgcacaacattctgcagcgtcctatggcgatc
aacggtcaagtggtcatccgtccgatgatgtacctggcgctgtcctacgatcaccgcctg
atcgacggtaaagaagccgtgacgttcctggtgaccatcaagaacctgctggaagacccg
gctcgtctgctcctggacatctaa

DBGET integrated database retrieval system