KEGG   Pseudomonas protegens Pf-5: PFL_1721Help
Entry
PFL_1721          CDS       T00249                                 

Gene name
sucC
Definition
(GenBank) succinate-CoA ligase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00020  Citrate cycle (TCA cycle)
pfl00640  Propanoate metabolism
pfl00660  C5-Branched dibasic acid metabolism
pfl01100  Metabolic pathways
pfl01110  Biosynthesis of secondary metabolites
pfl01120  Microbial metabolism in diverse environments
pfl01130  Biosynthesis of antibiotics
pfl01200  Carbon metabolism
Module
pfl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PFL_1721 (sucC)
   00640 Propanoate metabolism
    PFL_1721 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PFL_1721 (sucC)
Enzymes [BR:pfl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PFL_1721 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: AAY91016
UniProt: Q4KFY6
Position
1927717..1928883
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGYAVDTPEEAAEACDKIGGSEWVVKAQVHAGGRGKAGGV
KLVRSKEDAKAFAQQWLGKRLVTYQTDANGQPVTKILVESCTDIAKELYLGAVVDRSSRR
IVFMASTEGGVDIEKIAHDTPEKILKATIDPLVGAQPFQGRELAFQLGLEGKQVAQFAKI
FVGLAKLFQDHDLALLEVNPLVIKADGDLHCLDAKINIDANAMYRQPKLKTFHDPSQDDP
REAHAAKFELNYVALEGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDTNVAAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKIPVVVRLEGNNAELGAKV
LAESGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtatcagggtaagcagctgttcgctgaatacggcctgccagtatcc
aaaggctacgcggtagacaccccggaagaagcagcagaagcttgcgacaaaatcggcggc
tccgagtgggttgtcaaagcccaggttcacgccggtggtcgcggtaaagcgggcggcgtt
aagctggttcgcagcaaagaagacgctaaggcattcgctcagcagtggttgggcaagcgt
ctggtgacctatcagactgacgccaatggccagcctgtcaccaagatcctggttgaatcg
tgcactgatatcgctaaagagctgtacctgggcgctgtcgttgaccgttcgagccgtcgc
atcgtgttcatggcttccaccgaaggtggcgtggacatcgagaaaatcgctcacgacact
ccagaaaaaattctcaaggccactatcgatccactggttggcgctcagccattccagggg
cgcgagctggctttccaactgggtctggaaggcaagcaagttgcccagttcgccaagatc
ttcgtaggtctggccaaactgttccaggatcacgatctggccctgctggaagtgaacccg
ctggtgatcaaggccgacggcgatctgcactgcctggacgcgaagatcaacatcgacgcc
aacgccatgtaccgtcagcctaagctgaaaaccttccacgatccgtcccaggacgatccg
cgcgaagcccacgctgccaagttcgaactgaactacgtagctctggaaggcaacatcggc
tgcatggtcaacggtgccggcctggccatgggtaccatggacatcgtcaacctgcacggc
ggcaagccagccaacttcctcgacgtaggtggtggtgctaccaaagagcgcgtgaccgaa
gccttcaagatcatcctgtccgacaccaacgtcgctgcagtactggtcaacatcttcggc
ggcatcgttcgctgcgacatgattgccgaaggcatcatcggcgccgtgaaagaagtcggc
gtgaaaatcccggttgttgttcgccttgaaggcaacaacgctgaactgggcgctaaagta
ctggcagaaagcggcttgaacatcatcgctgctaccagcctgaccgacgctgctcaacaa
gttgtcaaagctgcggagggcaaataa

DBGET integrated database retrieval system