KEGG   Pseudomonas protegens Pf-5: PFL_2172Help
Entry
PFL_2172          CDS       T00249                                 

Gene name
acoC
Definition
(GenBank) acetoin dehydrogenase E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00010  Glycolysis / Gluconeogenesis
pfl00020  Citrate cycle (TCA cycle)
pfl00620  Pyruvate metabolism
pfl01100  Metabolic pathways
pfl01110  Biosynthesis of secondary metabolites
pfl01120  Microbial metabolism in diverse environments
pfl01130  Biosynthesis of antibiotics
pfl01200  Carbon metabolism
Module
pfl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFL_2172 (acoC)
   00020 Citrate cycle (TCA cycle)
    PFL_2172 (acoC)
   00620 Pyruvate metabolism
    PFL_2172 (acoC)
Enzymes [BR:pfl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PFL_2172 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Biotin_lipoyl Hydrolase_4 Thioesterase Ndr PGAP1 GCV_H DUF915 Esterase Abhydrolase_5 Ser_hydrolase
Motif
Other DBs
NCBI-ProteinID: AAY91446
UniProt: Q4KEQ4
Position
2428347..2429459
Genome map
AA seq 370 aa AA seqDB search
MSQIHTLTMPKWGLSMTEGRVDAWLKEEGQSISKGDEVLDVETDKISSSVEAPFSGILRR
QIARQDETLAVGALLGIVVDGEASDAEIDAVIEQFQASFVPGDSADEDSGPAPQKVELGG
RLIRYFERGEGGTPLLLVHGFGGDLNNWLFNHEALAAGRRVIALDLPGHGESAKALQRGD
LDELSQVLLALLDHLEIPVAHLVGHSMGGAVSLNTARLAPDRVRTLTLIGSAGLGREING
DYLQGFVEASNRNALKPQLVQLFSNAELVNRQMLDDMLKYKRLEGVQAALGQLAGNLFAD
GRQHADLRPVVQDGPQPVLVIWGSDDRIIPVSHSADLKAQIEVLPGQGHMLQMEAAEQVN
RLILDFIQQH
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagccagatccataccctgaccatgcccaagtggggcctgtcgatgaccgagggccgg
gtcgatgcctggctcaaggaagaaggccagagcatcagcaagggcgatgaagtgctggac
gtggagaccgacaagatctccagcagcgtcgaggcgccgttctccggcatcctgcgtcgg
cagatcgcccgccaggacgagaccctggcggtgggcgcgctgctgggcatcgtggtcgat
ggcgaggccagtgacgccgagatcgacgcggtgatcgagcagttccaggccagcttcgtg
cccggcgacagcgccgatgaagatagcggcccggcgccgcagaaggtcgaactgggcggc
cgcctgatccgctatttcgagcgcggtgaaggcggtacgccgctgctgctggtgcacggc
tttggcggcgacctcaacaactggctgttcaaccacgaagccctggccgccgggcgccgg
gtgatcgccctcgacctgccgggccatggtgagtcggccaaggccctgcaacggggcgac
ctggacgagttgagccaggtgctgctggcgctgctggatcacctggagattcccgtggcc
catctggtgggccactccatgggcggcgcggtgtccctcaacaccgcgcggctggcgccg
gaccgcgtgcgcaccctgaccctgatcggcagcgccgggctgggccgcgagatcaacggc
gactacctgcaaggttttgtcgaggccagcaaccgcaatgcgctcaagccgcagctggtg
cagctgttctccaacgccgagctggtgaaccggcagatgctcgacgacatgctcaagtac
aagcgcctggaaggggtgcaggcggccctcgggcagttggccggcaacctgtttgccgac
ggccgccagcacgccgacctgcgcccggtggtgcaggacggcccgcagccggtgctggtg
atctggggcagcgacgaccggatcattccggtgagccacagcgccgatctcaaggcgcag
atcgaggtgctgccggggcaggggcacatgctgcagatggaagcggcggagcaggtcaac
cgcctgatcctcgactttatccagcagcactga

DBGET integrated database retrieval system