KEGG   Pseudomonas protegens Pf-5: PFL_2173Help
Entry
PFL_2173          CDS       T00249                                 

Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PFL_2173
Enzymes [BR:pfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PFL_2173
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PFL_2173
    1.1.1.-  
     PFL_2173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C UDPG_MGDP_dh_N DAO
Motif
Other DBs
NCBI-ProteinID: AAY91447
UniProt: Q4KEQ3
Position
2429548..2430621
Genome map
AA seq 357 aa AA seqDB search
MRAAVWHGRHDIRVEDVPLPDAPPAGWVQIRVDWCGICGSDLHEYVAGPVFIPVDAPHPL
TGIKGQCILGHEFCGEIVALGEGVQGFSVGQPVAADACQHCGTCYYCTHGLYNICENLAF
TGLMNNGAFAELVNVPANLLYALPANFPAEAGALIEPLAVGMHAVKKAGSLLGQNVVVVG
AGTIGLCTIMCAKAAGAAQVIALEMSGARKAKALEVGATHVLDPKECDALAEVKRLTGGL
GADVSFECIGNKHTAKLAIDLIRKAGKCVLVGIFEEPSEFNFFELVATEKTVLGALAYNG
EFADVIAFIADGRLDISPLVTGRIQLEEIVGQGFEELVNNKEHNVKIIVSPGQLRRS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccgcggtctggcacggccgccacgatatccgcgtcgaagacgtaccgctgccc
gacgcgccgcctgccggctgggtgcagatccgcgttgactggtgcggcatctgcggctcc
gacctgcacgaatacgtggccgggccggtgttcattccggtggacgcaccgcacccgctg
accgggatcaagggccagtgcatcctcggccacgagttctgcggcgaaatcgtcgccctg
ggcgaaggggtccagggtttcagcgttggccagccggtggccgccgacgcctgccagcac
tgcggcacctgctactactgcacccacggcctgtacaacatctgcgaaaacctggccttt
accgggctgatgaacaacggcgccttcgccgaattggtcaacgtgccggccaacctgctg
tacgccttgccggccaactttcccgccgaggccggagcgctgatcgagccgctggcggtg
ggcatgcacgcggtgaaaaaagccggcagtttgttggggcagaacgtggtggtggtcggc
gccggcaccatcggcctgtgcaccatcatgtgcgccaaggccgccggcgcggcccaggtg
atcgccctggaaatgtccggcgcgcgcaaggccaaggccctggaggtgggcgcgacccac
gtgctcgaccccaaggagtgcgatgccctggccgaggtcaagcgcctgaccggcgggctg
ggggccgatgtcagctttgagtgcataggcaacaagcacaccgccaagctggccatcgac
ctgatccgcaaggccggcaagtgcgtgctggtggggatattcgaagagcccagcgagttc
aacttcttcgagctggtggccaccgagaaaacggtgctgggggccctggcctacaacggt
gagttcgccgatgtgatcgcctttatcgccgatggccggctggatatttcgcccctggtg
accgggcgcatccagctggaagagattgtcggccagggcttcgaggaactggtcaacaac
aaggagcacaacgtcaagatcatcgtgtcccccggtcagttgcgacgctcgtaa

DBGET integrated database retrieval system