KEGG   Pseudomonas protegens Pf-5: PFL_2942Help
Entry
PFL_2942          CDS       T00249                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00071  Fatty acid degradation
pfl00072  Synthesis and degradation of ketone bodies
pfl00280  Valine, leucine and isoleucine degradation
pfl00310  Lysine degradation
pfl00362  Benzoate degradation
pfl00380  Tryptophan metabolism
pfl00620  Pyruvate metabolism
pfl00630  Glyoxylate and dicarboxylate metabolism
pfl00640  Propanoate metabolism
pfl00650  Butanoate metabolism
pfl00900  Terpenoid backbone biosynthesis
pfl01100  Metabolic pathways
pfl01110  Biosynthesis of secondary metabolites
pfl01120  Microbial metabolism in diverse environments
pfl01130  Biosynthesis of antibiotics
pfl01200  Carbon metabolism
pfl01212  Fatty acid metabolism
pfl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PFL_2942
   00630 Glyoxylate and dicarboxylate metabolism
    PFL_2942
   00640 Propanoate metabolism
    PFL_2942
   00650 Butanoate metabolism
    PFL_2942
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PFL_2942
   00072 Synthesis and degradation of ketone bodies
    PFL_2942
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PFL_2942
   00310 Lysine degradation
    PFL_2942
   00380 Tryptophan metabolism
    PFL_2942
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PFL_2942
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PFL_2942
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PFL_2942
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfl04147]
    PFL_2942
Enzymes [BR:pfl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PFL_2942
Exosome [BR:pfl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PFL_2942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AAY92214
UniProt: Q4KCI5
Position
3293239..3294537
Genome map
AA seq 432 aa AA seqDB search
MAEYSFNPAPVRRVAILGGNRIPFARSNTVYANDSNQDLLVAALQGLVDRYGLSGQRLGE
FAAGAVIKHSRDFNLARESLLSTTLSPQTPAYDLQQACGTGLEAALLVANKIALGQIEVG
IAGGADTTSDAPIGINEGLRRTLLQANRAKGTGNKLRSLLKVRPGMFFKPLLPRNGEPRT
GLSMGEHCEEMAKRWQIKRLAQDELALTSHHQLNAAYQRGFFDDLITPYRGLKRDNNLRA
DASLEKLAGLGPAYDRHNGTLTAGNSTPLTDGASVVLLASEDWAAANNLPVLAYLRTGET
AAVNFVDGSEGLLMAPAYAVPRMLAREGLSLEDFDFYEIHEAFAAQVLCTLKAWEDADYC
RDKLGLDGPLGSIERSKLNVNGGSLGCGHPFAATGGRQLATLAKAIHERGGGRGLISICA
AGGLGVTAIVEK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtacagtttcaatccggcgccggtacgccgggtggcgatcctgggcggtaac
cggattccgttcgcccgttccaacacggtatatgccaatgacagcaaccaggacctgctg
gtggcggcgttgcagggcctggtggatcgctacggcctgtcgggccagcgcctgggggag
ttcgccgcgggggcggtgatcaagcattcgcgggatttcaacctggcccgggaaagtctc
ttgtccaccaccctgtcgccgcagaccccggcctatgacctgcagcaggcctgcggcacc
gggcttgaggcggcgctgctggtggccaacaagatcgccctggggcagatcgaagtgggc
attgccgggggcgccgacaccacctccgacgcgcccatcggcattaacgaaggcctgcgc
cgcaccttgctccaggccaatcgcgccaagggcaccggcaacaagctgcgcagcctgctc
aaggtgcgcccggggatgttcttcaagccgttgctgccacgcaacggcgagccgcgcacc
gggctgtccatgggcgagcactgcgaagaaatggccaagcgctggcagatcaagcgcctg
gcccaggatgaactggccctcaccagccaccaccagttgaatgcggcctaccagcgcggc
ttcttcgatgacctgatcaccccgtaccgcggcctgaaacgcgataacaacctgcgggcc
gacgcgagcctggagaagctcgccggcctgggtccggcctacgaccggcacaacggcacc
ctgaccgccggcaactcgaccccgctcaccgatggcgcctcggtggtgctgctggccagc
gaagactgggcggcggccaacaacctgccggtgctggcctacctgcgtaccggggaaacc
gcagcggtgaactttgtcgacggcagtgaagggctgctgatggccccggcctatgccgtg
ccgcgcatgctcgcccgggagggcctgagcctggaggatttcgacttctacgagatccac
gaagcctttgccgcccaggtgctgtgcaccctcaaggcctgggaggacgctgattactgc
cgggacaagctcggcctcgacggaccgctgggcagcatcgagcgcagcaagctcaacgtc
aacggcggctccctgggctgcgggcatccgttcgccgccaccggtgggcggcaactggcg
accctggccaaggcgatccatgagcgcggcggcggccgcgggctgatttccatctgtgca
gcaggcgggctgggcgtaaccgccatcgtcgaaaaataa

DBGET integrated database retrieval system