KEGG   Pseudomonas protegens Pf-5: PFL_3037
Entry
PFL_3037          CDS       T00249                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pfl  Pseudomonas protegens Pf-5
SSDB
Motif
Pfam: Glucosaminidase
Other DBs
NCBI-ProteinID: AAY92307
UniProt: Q4KC90
Structure
PDB: 
4KT3

Position
complement(3502760..3503293)
AA seq 177 aa
MGPGLLYNHAAKTAVNGIDRSTEGTNVSARLCNNISAVTFVSKYKAVCQPIADQLDLPVE
NLLGLAAQESQYGTGRIARELNNYFSMHAPAPLQIGAEAPLGNASIKVAKFDSFQKSAQS
FASSFGTAVRGQRDPMAFAQALVRSGYNTGNAKTGGRDGFARYLADIIIAVRGRMAC
NT seq 534 nt   +upstreamnt  +downstreamnt
gtgggccccgggttgctttataatcacgcggcgaaaaccgcagtaaatggaattgaccgg
tcaaccgagggaacaaacgtgagcgccagactctgcaacaacatcagtgccgtgaccttt
gtcagcaagtacaaggcggtgtgccagccgattgccgaccagctggacctgccggtggaa
aacctgctgggcctggccgcccaggaaagccagtacggcaccgggcgcattgcccgggaa
ctgaacaactacttttccatgcacgcaccggcccccctgcagatcggcgccgaggcgccc
ctgggcaacgccagcatcaaggtggccaagttcgactccttccagaagtccgcccagtcc
tttgcttcgagctttggcacggcagtacgtggccagcgtgaccccatggcattcgcccag
gcgctggtacgcagcggctacaacaccggcaacgccaagaccggcggccgggatggcttc
gcccgctacctggcggacatcatcatcgcggtcagagggcgcatggcgtgctga

DBGET integrated database retrieval system