KEGG   Pseudomonas protegens Pf-5: PFL_3045Help
Entry
PFL_3045          CDS       T00249                                 

Gene name
arnA
Definition
(GenBank) bifunctional polymyxin resistance protein ArnA
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00520  Amino sugar and nucleotide sugar metabolism
pfl01100  Metabolic pathways
pfl01503  Cationic antimicrobial peptide (CAMP) resistance
Module
pfl_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:pfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PFL_3045 (arnA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    PFL_3045 (arnA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pfl01005]
    PFL_3045 (arnA)
Enzymes [BR:pfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     PFL_3045 (arnA)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     PFL_3045 (arnA)
Lipopolysaccharide biosynthesis proteins [BR:pfl01005]
 Unusual sugar
  PFL_3045 (arnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase Formyl_trans_N GDP_Man_Dehyd Formyl_trans_C NAD_binding_10 3Beta_HSD TrkA_N NAD_binding_4 RmlD_sub_bind Uds1
Motif
Other DBs
NCBI-ProteinID: AAY92315
UniProt: Q4KC82
Position
3511106..3513112
Genome map
AA seq 668 aa AA seqDB search
MSNKAVVFAYHDIGCAGIEALLNAGYEIAAVFTHADDPKENTFYGSVAQLCARKGIAVHA
PEDANHPLWIERIAKLNPDYLFSFYYRNLLSEPLLATASKGAFNLHGSLLPRYRGRAPAN
WVLVKGETETGVTLHRMVKRADAGAIIAQERVAIERSDTALSLHHKLRDAAASLLRDTLP
ALAQGKITETAQDESKASYFGRRTAADGKIDWQRPAEELFNLVRAVTQPYPGAFCAVGEH
KLIVWSAEVAKGNEGQAPGRVISVDPLRIACGQDSLVITSGQRNANGLFLGGPQLANELG
LVDGSLLRGAESGRKPRRTRVLILGVNGFIGNHLSERLLRDDKYDVYGLDIGSDAIERLR
SHPNFHFVEGDISIHSEWIEYHIKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLKLV
RYCVKYNKRVIFPSTSEVYGMCQDKNFDEDTSNLIVGPINKQRWIYSVSKQLLDRVIWAY
GAKGLNFTLFRPFNWMGPRLDRLDSARIGSSRAITQLILNLVEGTPIRLFDGGEQKRCFT
DIADGIEALARIVDNENDCCNGQIINIGNPDNEASIRQLGEELLRQFEAHPLRGNFPPFA
GFRDVESKAFYGAGYQDVEHRKPSIDNAKRLLNWEPTVEMSETIGNTLDFFLREAMLEIA
DRAKQEAR
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataaagctgttgtcttcgcctaccacgatattggctgtgctggcatcgaagcc
ctgctcaacgcaggttacgagatcgccgccgtgttcacccacgccgatgaccccaaggaa
aacaccttctacggctcggtggcccagctctgcgcccgcaagggcattgccgtgcatgcc
ccggaagatgccaaccacccgctgtggatcgagcgcatcgccaagctcaaccccgactac
ctgttctccttctattaccgcaacctgctgagcgagccgctgctggccactgccagcaag
ggcgcgttcaacctgcacggctcgctgctgccgcgctaccgtggccgcgcaccggccaac
tgggtgctggtcaagggcgaaaccgaaaccggcgtgaccctgcaccgcatggtcaagcgt
gccgatgccggcgccatcattgcccaggagcgtgtggccatcgagcgcagcgacaccgcg
ctgagcctgcaccacaaactgcgtgacgccgccgccagcctgctgcgcgacaccctgccg
gcactggcccagggcaagatcaccgaaaccgcccaggacgagtccaaggccagctacttc
ggtcgtcgcaccgcggcggacggcaagatcgactggcagcgtccggccgaagagctgttc
aacctggtgcgcgccgtgactcaaccctacccgggcgccttctgcgccgtgggcgagcac
aagctgatcgtctggagcgccgaagtcgccaagggcaacgaaggccaggccccgggccgg
gtcatcagcgtcgacccgctgcgcatcgcctgtggccaggactccctggtgatcacctcc
ggccagcgcaacgccaacggcctgttcctgggtggcccgcaactggccaacgaactgggc
ctggtggacggttccctgctgcgcggcgccgaatcggggcgcaagccacgtcgcacccgc
gtactgatcctgggcgtcaacggctttatcggtaaccacctgtccgagcgcctgttgcgt
gacgacaagtacgacgtctatggcctggacatcggctccgacgccatcgagcgcctgcgc
agccatccgaacttccacttcgtcgaaggcgatatcagcattcactccgagtggatcgaa
tatcacatcaagaagtgcgacgtggtcctgccactggtggccatcgccaccccgatcgag
tacacccgcaacccgttgcgcgtgttcgagctggacttcgaagagaacctcaagctggtt
cgctactgcgtcaagtacaacaagcgcgtgatcttcccatcgacttcggaagtctatggc
atgtgccaggacaagaacttcgacgaagacacctccaacctgatcgtcggcccgatcaac
aagcagcgctggatctactcggtctccaagcagctgctggaccgggtgatctgggcctac
ggcgccaagggcctgaacttcaccctgttccgtcccttcaactggatgggcccgcgcctg
gaccgcctggactcggcacgcatcggcagctcccgggccatcacccagttgatcctcaac
ctggtggaaggcaccccgatccgtctgttcgacggtggcgagcagaagcgctgcttcacc
gacatcgccgacggcatcgaagccctggcacgcatcgtcgacaacgaaaacgactgctgc
aacggccagatcatcaacatcggcaacccggacaacgaagccagcatccgtcagctgggc
gaagagctgctgcgccagttcgaagctcacccgctgcgcggcaacttcccgccgttcgcc
ggtttccgcgatgtggagagcaaggcgttctacggtgccggctaccaggacgtggaacac
cgcaagccaagcatcgacaacgccaagcgcctgctgaactgggagccgaccgtggaaatg
agcgaaaccatcggcaataccctggacttcttcctgcgtgaagcgatgctggaaatcgcc
gaccgcgccaagcaagaagcacgctga

DBGET integrated database retrieval system