KEGG   Pseudomonas protegens Pf-5: PFL_3249Help
Entry
PFL_3249          CDS       T00249                                 

Definition
(GenBank) protein-glutamate methylesterase, CheB family
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl02020  Two-component system
pfl02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PFL_3249
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PFL_3249
Enzymes [BR:pfl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PFL_3249
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     PFL_3249
Two-component system [BR:pfl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   PFL_3249
Bacterial motility proteins [BR:pfl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PFL_3249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest
Motif
Other DBs
NCBI-ProteinID: AAY92518
UniProt: Q4KBM9
Position
complement(3750534..3751142)
Genome map
AA seq 202 aa AA seqDB search
MSQEIVSQGFWPQIEAIVVGASAGGVEALLKLFSGFAQGFRLPVIVVLHLPDERRSQLAE
VFDRRLALAVKEADDKEQIVPGTLYFAAPGYHLSVEQDRSLSLSQEERLHHSRPAIDYLF
ESAADAYGRNLAAVLLTGANQDGARGLAEVKRQGGLTIVQDPNEAHVSTMPDAALALHQP
DYILPLRGISRLLAELEGTHVK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggagattgtcagccagggtttctggccgcagatcgaggcgatcgtggtaggg
gcctctgcgggtggggtcgaagccttgctgaagctgttcagcggtttcgcccagggtttc
cgcctgccggtgatcgtggtcctgcacctgcccgacgagcgccgcagccagctggccgaa
gtcttcgaccggcgtctggcgctggcggtgaaggaagccgacgacaaggagcagatcgtg
cctggcaccctgtacttcgccgcgcccggctatcacttgtcggtggagcaggaccgcagc
ctgtccctgagccaggaagaacgcctgcaccactcacgcccggccatcgactacctgttc
gagtccgccgccgatgcctatggccggaacctggccgcggtgctcctgaccggggccaac
caggatggcgcccgcggcctggccgaggtcaagcgccagggtggcctgaccatcgtccag
gaccccaatgaggcccatgtctcgaccatgccggacgccgccctggccctgcatcaaccg
gactacattctccctttgcgcggcatcagccgtctgcttgccgagctggaaggaacccat
gttaagtaa

DBGET integrated database retrieval system