KEGG   Pseudomonas protegens Pf-5: PFL_4621Help
Entry
PFL_4621          CDS       T00249                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00010  Glycolysis / Gluconeogenesis
pfl00052  Galactose metabolism
pfl00500  Starch and sucrose metabolism
pfl00520  Amino sugar and nucleotide sugar metabolism
pfl00521  Streptomycin biosynthesis
pfl01100  Metabolic pathways
pfl01110  Biosynthesis of secondary metabolites
pfl01120  Microbial metabolism in diverse environments
pfl01130  Biosynthesis of antibiotics
pfl01200  Carbon metabolism
Module
pfl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFL_4621 (glk)
   00052 Galactose metabolism
    PFL_4621 (glk)
   00500 Starch and sucrose metabolism
    PFL_4621 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PFL_4621 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PFL_4621 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PFL_4621 (glk)
Enzymes [BR:pfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PFL_4621 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AAY93868
UniProt: Q4K7S8
Position
complement(5331322..5332278)
Genome map
AA seq 318 aa AA seqDB search
MKLALVGDIGGTNARFALWKDQQLEAIEVHATADYSCPEDAIKAYLRDQGLALGAIGSVC
LSVAGPVSGDEFRFTNNHWRLSRQAFCQALQVDQLLLVNDFSAMALGMTRLQPDEFRVVC
EGVAEPLRPAVVIGPGTGLGVGTLLNFGDGRYMALPGEGGHVDLPLSSARETQLWQHIHD
EIGHVSAETALSGGGLPRVYRAICAVDGHEPRLETPEAITAAGLAGDPIAREVLEQFSCW
LGRVAGNNVLTTGGRGGVYIVGGVIPRFADFFIHSGFAKSFADKGCMSDYFKGIPVWLVT
APYSGLTGAGVALEQAQG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactggccctggtcggtgatatcggtggcaccaacgcgcgcttcgcgttgtggaaa
gaccaacaactggaggcgatcgaagtccacgccaccgcggactacagctgcccggaagac
gccatcaaggcctacctgcgggaccaggggctggccctgggtgccataggttcggtgtgc
ctgtcggtggccggcccggtcagcggcgatgagtttcgcttcaccaacaaccactggcgc
ctgagccgccaggctttctgccaggctttgcaggtggaccaactgctgttggtcaatgac
ttctcggccatggccctgggcatgacccgcctgcagccggatgaatttcgcgtggtctgc
gaaggcgttgccgagcccttgcgcccggccgtggtgatcggcccgggcacgggcctcggg
gtgggcaccctgctgaacttcggcgacggtcgttacatggccttgccgggagagggcggg
catgtcgacctgcccttgagcagtgcgcgggaaacccagctctggcagcacattcacgac
gagatcggccatgtcagcgccgagaccgccctcagcggtggcggcctgccccgggtgtat
cgggcgatctgtgcggtggacggccatgagccgcggctcgagactccggaggccatcacc
gcggccggcctggccggcgacccgatcgcccgggaagtgctggagcagttcagctgctgg
ctgggccgggtggcgggcaacaacgtgctgaccaccggggggcgtggcggggtgtacatc
gtcggtggggtgattccgcgctttgccgatttcttcatccacagcggctttgccaagagc
tttgccgacaagggttgcatgagcgattacttcaagggcatcccagtgtggctggtgacc
gcgccctattccgggctcaccggtgccggcgtggccctggagcaggcccagggctga

DBGET integrated database retrieval system