KEGG   Pseudomonas protegens Pf-5: PFL_5650Help
Entry
PFL_5650          CDS       T00249                                 

Gene name
apaG
Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
pfl  Pseudomonas protegens Pf-5
Brite
KEGG Orthology (KO) [BR:pfl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PFL_5650 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AAY94843
UniProt: Q4K4X4
Position
6436347..6436727
Genome map
AA seq 126 aa AA seqDB search
MSDPRYQVDVSVVTRFLADQSQPEQNRFAFAYTITVQNNGSLPAKLLSRHWVITDGDGHV
EEVRGAGVVGQQPLIAAGKSHTYSSGTVMTTRVGNMQGSYQMLAEDGKQFDAVIAPFRLA
VPGALH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcctcgttaccaggtcgacgtcagcgtcgtcactcgctttctggcagaccaa
tcgcaacccgagcagaaccgcttcgctttcgcctacaccatcaccgtgcagaacaatggc
tcgcttccagccaagctgctgtcccggcactgggtgatcaccgatggcgacgggcatgtc
gaagaggtccgtggtgccggcgtggtgggccagcaaccgctgatcgccgcaggcaaaagc
cacacctacagcagcggcacggtaatgaccacccgggttggcaacatgcagggcagctat
cagatgctcgccgaggatggcaaacagttcgacgccgtcattgcgcccttccgcctggcc
gtgcccggagccttgcactga

DBGET integrated database retrieval system