KEGG   Pseudomonas protegens Pf-5: PFL_6001Help
Entry
PFL_6001          CDS       T00249                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00860  Porphyrin and chlorophyll metabolism
pfl01100  Metabolic pathways
pfl01110  Biosynthesis of secondary metabolites
pfl01120  Microbial metabolism in diverse environments
Module
pfl_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PFL_6001 (hemD)
Enzymes [BR:pfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PFL_6001 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AAY95190
UniProt: Q4K3X4
Position
complement(6821328..6822095)
Genome map
AA seq 255 aa AA seqDB search
MTGWRLLLTRPAEDCAALAAILAQSEILSSSLPLLEIQALPVSDSQRATLLAFDQYCAVI
VVSKPAAHLGLELLRQYWPQPPDQAWFTVGAATAQILADAGLPVAYPQQGDDSEALLELP
QLREAIRRPDPRVLIVRGEGGRELLSERLRALGASVDYLELYRRCLPHYAEGALLQRIEV
ERLNGLVVSSGQGFSHLRQLAGPAWPQLAKMPLFVPSPRVADMAHAAGAEKVVDCRGASA
AALLTALREQPVPVL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgactggctggcgcctgctgctgacccggccggccgaggactgcgccgcgctggcggcg
atcctggcgcagtccgagatcttgagcagcagcctgccattgctggaaatccaggcgttg
ccggtcagtgactcgcagcgggctaccctgctggcattcgaccagtactgtgcggtgatt
gtggtcagcaagccggcggcgcatcttggcctggagctgttgcgccagtattggccgcaa
ccaccagaccaggcctggttcaccgtaggcgccgctaccgcgcagatccttgcggatgcc
ggcttgccagtggcctatccccagcagggcgatgacagtgaagccttgcttgaacttccc
caattgcgcgaggctatccgccggcctgatccacgggtgttgatcgtgcgcggggagggt
gggcgcgagctgctctctgagcgcttgcgcgccctaggtgctagtgtcgattatctggaa
ctctaccgccgctgcctgccgcactacgccgaaggcgcgttgctccagcggattgaagtg
gaacgcttgaacgggctggtggtcagcagtggacaaggtttcagccacttgcggcagctg
gcggggcccgcctggccgcaactggcgaagatgccgttgtttgttccaagcccccgggtc
gccgacatggcgcacgccgcaggggcggaaaaagttgtggattgtcgcggcgccagtgcc
gcggctttgctaacggcgttacgggagcaacccgtgcccgttctctaa

DBGET integrated database retrieval system