KEGG   Pseudomonas protegens Pf-5: PFL_6083
Entry
PFL_6083          CDS       T00249                                 

Gene name
tssK
Definition
(GenBank) type VI secretion protein TssK
  KO
K11893  type VI secretion system protein ImpJ
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pfl00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PFL_6083 (tssK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfl02044]
    PFL_6083 (tssK)
Secretion system [BR:pfl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PFL_6083 (tssK)
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: AAY95271
UniProt: Q4K3P2
Position
complement(6909144..6910478)
AA seq 444 aa
MSWNNRVVWSEGMFIGTQHFQQHDRYLENLIDARSRPLSTGAWGFSELRIDQGLLAQGKL
AIVSARGLLPDGTPFNIPHDDLAPSPLCIDDNLRDGLVYLALPLKRAGARDTVDEGEELG
GARYLSQVREVRDDNAPFENRAPVAVGSRALRLLTAQDGLSDYAAIGVVRVKEKRADRAL
VLDDSYIPPVLDVAASKPLSAFRSELLGLLHQRGEALAGRVVASGAGGASEIADFMLLQL
VNRAQPLVNHLSQISPLHPERLFSELVSLAGEFSTFTHSARRPEQYPQYQHDELAMSFAP
VMQALREALSMLIDSKATPIPIVEKAYGVHVAMLADRTLLENASFILVVRADVPGETLRG
RFAQQSKVGSVEHIRDLVNLQLPGIGLLPLPVAPRQLPYHAGSTYYELDRGSEHWKQLVH
SGGFAFHVAGEFPGLNLAFWAIRG
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgtcctggaacaatcgcgtggtctggtcggaaggcatgttcattggaacccagcacttc
cagcagcatgaccgttacctggaaaacctcatcgacgcccgcagccgcccgctgtcgacg
ggagcctgggggttctccgagctgcgtatcgatcagggcctgctggcccagggcaagctg
gccatcgtcagcgcccgtggcctgctgcccgacggcacgccgttcaacattccccatgac
gacctggcgcccagcccgttgtgcatcgacgacaacctgcgtgacggcctggtgtacctg
gcgctgcccctcaagcgcgccggcgcccgggacaccgtggacgagggcgaagagctgggc
ggtgcccgctacctgagccaggtgcgcgaggtgcgtgacgacaacgcaccgttcgagaac
cgcgcgccggtggccgtgggctctcgggccctgcgcctgctcaccgcccaggacggcctc
agcgactacgccgccattggcgtggtgcgggtcaaggagaaacgcgccgaccgtgctctg
gtgctggacgacagctacattccgccggtgctggacgtggccgcgtccaagccgttgagc
gcctttcgcagcgagctgctgggcctgctgcaccagcgcggcgaagccctggccgggcgc
gtggtggcatcgggcgcggggggcgcttcggaaatcgccgacttcatgctcctgcaactg
gtgaaccgcgcccagcccctggtcaaccacctgagccagatcagcccgctgcaccccgag
cgcctgttcagcgagctggtgagcctggccggcgagttctcgaccttcacccacagcgcc
cggcgccctgagcaatacccgcagtaccagcacgatgagctggccatgagtttcgccccg
gtgatgcaggccctgcgtgaagcgctgtcgatgctgatcgacagcaaggcaacgccgatc
cccatcgtcgagaaagcctacggcgtacacgtggcgatgctggccgaccgcaccctgctg
gagaacgccagcttcatcctggtggtgcgtgccgacgtgccgggcgaaaccctgcgcggg
cgcttcgcccagcagagcaaggtgggttcggtggagcacatccgcgacctggtcaacctg
cagctgccgggcatcggcctgctgccgctgccggtggcgccgcggcaactgccgtaccac
gcaggctcgacctactacgagctggaccgtggcagcgagcactggaaacaactggttcac
tccggcggcttcgcgttccacgtcgcgggagaattcccgggcttgaacctggccttctgg
gccattcgaggataa

DBGET integrated database retrieval system