KEGG   Pseudomonas protegens Pf-5: PFL_6085Help
Entry
PFL_6085          CDS       T00249                                 

Gene name
fha
Definition
(GenBank) type VI secretion protein Fha
  KO
K11913  type VI secretion system protein
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl02025  Biofilm formation - Pseudomonas aeruginosa
pfl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pfl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PFL_6085 (fha)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PFL_6085 (fha)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfl02044]
    PFL_6085 (fha)
Secretion system [BR:pfl02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PFL_6085 (fha)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHA Yop-YscD_cpl
Motif
Other DBs
NCBI-ProteinID: AAY95273
UniProt: Q4K3P0
Position
complement(6911065..6912549)
Genome map
AA seq 494 aa AA seqDB search
MSLCLTITSYHKITPGQCPEKLMDQGMMAIGRSSDNDWVLPDPERLVSARHCVIQYKDGR
YYLTDNSTNGVELVRAGIRMRRGSSEPLEDGEVIRIGDYEISARIDFSLNRPGAEPFSGD
SSNSFEALMGRQAASPTPIEPISMAPVAHFQGASAQDTFPDLFDFLAPSATPPATQPDHV
PAEQHDFRPPTPTAVPQPVAPPEPSAPQGGAVIPEDWDLFGSTPASPAPVPSAPPVVAPP
VVAAAPIAHQASFAAEPAQPQPQPQPQPQPIAQAPVAPVVSEVELAPVVTPAPAPVAPQG
DLLQAFLRGAGLDQLRIEPQQAQAQMESLGRSYRLMVEGLIDVLRARSSLKGEFRMQQTM
IRPVENNPLKFAPNVDEAMLLLLRHSNQAFMAPDQAVQDSFDDLRAHQLAVMAGVEAAIK
HLLGRFEPTELEARMARPGGLGNLFSGSRQAQNWQQFTALYKQISQEAQDDFQDLFGREF
SRAYEEHTHRLRRS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgtgtttgactatcactagttatcacaagattacccctggtcaatgccctgaa
aaactaatggaccagggaatgatggcaattggccgcagttccgataatgactgggtactt
cctgatcccgaacgcttagtttccgcgcggcactgtgtcatccaatacaaggatggccgt
tattatttgaccgataacagtactaatggtgtggagttagtccgtgccggtattcgtatg
cgccggggtagcagcgagcctctggaagatggcgaggttattcgcattggcgattatgaa
atcagtgcgcgcatcgatttcagtctgaaccgcccgggggctgaacccttttccggggac
agctccaatagtttcgaggcgctgatggggcgtcaggcggcttcgccgacccccatcgaa
ccgatttccatggccccggtggcgcacttccagggtgcctcggcccaggacacctttccc
gatctgttcgactttctcgcccccagcgcgaccccgccggccacccaaccggaccacgtg
ccggccgagcagcacgattttcgcccgccgacccccaccgcggtgccccagcccgtggca
ccgcctgagccatcggcgccccagggcggggcggtgattccggaggactgggacctgttc
ggctcgacgcccgcaagccctgcgccagtgcccagtgcgccgcccgtggttgccccgccg
gtggttgccgccgcgccgattgcccaccaggcctcgttcgcggcagaacccgcgcagccg
cagccgcagccgcagccgcagccgcagccgatcgcccaggcgcccgtggcaccggtggtt
tccgaagtggagctggctcctgttgtcacgcccgcgccggccccggtcgccccccagggg
gatctgctccaggccttcctgcgcggggccgggctcgatcaactgcgtatcgagccgcag
caggcccaggcccagatggaaagcctgggtcgcagctaccggttgatggtcgagggcctg
atcgatgtattgcgtgcccgtagcagcctcaagggcgagttccgcatgcagcagacgatg
atccgcccggtggaaaacaacccgctgaagttcgcccccaatgtggacgaggccatgctc
ctgctgctgcgccacagcaaccaggcattcatggctccggatcaggccgtgcaggacagt
ttcgatgacctgcgggcgcaccagctggcggtcatggccggtgtggaagcggccatcaag
cacctgctggggcgcttcgagcccactgaactggaagctcgcatggctcgccccggcggc
ctgggcaatctgttcagcggctcgcgccaggcgcagaactggcagcagttcactgcactc
tacaaacagatttcccaagaggcccaggacgatttccaggacctcttcggtcgtgagttc
agccgcgcctatgaagaacacacccaccggctgcgccgttcctga

DBGET integrated database retrieval system