KEGG   Pseudomonas protegens Pf-5: PFL_6087
Entry
PFL_6087          CDS       T00249                                 

Gene name
tssB
Definition
(GenBank) type VI secretion protein TssB
  KO
K11901  type VI secretion system protein ImpB
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pfl00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PFL_6087 (tssB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfl02044]
    PFL_6087 (tssB)
Secretion system [BR:pfl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PFL_6087 (tssB)
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AAY95275
UniProt: Q4K3N8
Position
6914043..6914558
AA seq 171 aa
MAKQSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPVEPLAAVADRK
FLEIDVDNFDSRLKAMQPRVAFHVPNELTGEGNLSLDITFESMDDFSPAAVARKVDSLNQ
LLEARTQLANLLTYMDGKTGAEEIIMKAIKDPALLQALASAPKPADSEPNA
NT seq 516 nt   +upstreamnt  +downstreamnt
gtggcgaagcaaagttctcaaaagttcatcgcgcgcaaccgcgcgccccgggtgcagatc
gagtacgacgtcgaactctacggcgccgagaaaaaggtccagctgcccttcgtcatgggc
gtgatggccgacctcgccggcaagcccgtggagcccctggcggccgtggccgatcgcaag
ttcctggaaatcgacgtcgataacttcgactcgcgcctcaaggccatgcagcctcgggtg
gccttccacgtgcccaacgaactgaccggcgaaggcaacctgagcctggacatcaccttc
gagagcatggacgacttcagcccggcggccgtggcgcgcaaggtcgattcgttgaaccag
ttgctggaagcccgcacccagctggccaacctgctgacctacatggacggcaagaccggc
gccgaagaaatcatcatgaaagccatcaaggatccggcgttgctccaggccctggccagt
gcgccaaagcctgctgactccgagccgaacgcgtaa

DBGET integrated database retrieval system