KEGG   Pseudomonas protegens Pf-5: PFL_6094
Entry
PFL_6094          CDS       T00249                                 

Gene name
vgrG
Definition
(GenBank) type VI secretion protein VgrG
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pfl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PFL_6094 (vgrG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfl02044]
    PFL_6094 (vgrG)
Secretion system [BR:pfl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PFL_6094 (vgrG)
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C
Other DBs
NCBI-ProteinID: AAY95282
UniProt: Q4K3N1
Position
6923022..6924959
AA seq 645 aa
MLFQQSTRLAQVNCPLGPDVLLLKSLGGGEELGRLFDYQLQLASSDANIDLNQLLGKPMG
LSVQLDGGGQRYFHGIVARCSQNIDTGQFASYEVTLRPWLWLLSRTSDCRIFQNLSIPQI
IKQVFRDLGFSDFEDALSRPYREWEYCVQYRETSFDFVSRLMEQEGIYYFFRHEKDRHVV
VLADAYGAHSSVPGYASVPYYPRDEQQRERDHMFDWHLAQEVQPGSLELNDYDFQRPSAR
IDVRSAMPRPHSAGDYPLYDYPGTYVQSSDGEHYAQTRIEALQSLHERIELSGNARGLGV
GNLFSLTGFSRQDQNREYLIVSIRYYLVQESLESGAGGGSAQFESHLTCIDAQQSFRPLA
TTHKPMVQGPQTARVVGPAGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYDLPANATQSGMKSRSSKGG
SPANFNEIRMEDKKGAEQLYIHAERNQDIVVEVNESHSVGNNRNKSIGHDEYVTIGNKRT
RIVQHVDELRVGEKKLDSVGQSYVIEVGERLRLVCGASILELNASGQINLCGVNISVHAS
ADAQINTGGVLHLNNGGGPGTTTEGQGVQGAISAKAKAPFSAPKG
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgttatttcagcaatccacacgactggcacaggtcaactgccccctgggcccggacgtc
ctgctgctcaagagcctgggcggcggcgaggagctggggcggctgttcgactaccagctg
caactggcctccagtgacgccaacatcgacctcaaccagttgctgggcaagcccatgggc
ctcagcgtacagctggacggcggcggccagcggtacttccacggcatcgtcgcgcgctgc
agccagaacatcgacaccggccagttcgccagctacgaggtgacgctgcgcccctggctg
tggctgctgagccgcacctccgactgccggatcttccagaacctgagcatcccgcagatc
atcaagcaggtgttccgcgacctgggcttttccgatttcgaagacgccctgagccgcccc
taccgggagtgggagtactgcgtgcagtaccgcgagaccagcttcgatttcgtcagccgg
ctgatggaacaggaaggtatctactacttcttccgccacgagaaggaccgccacgtggtg
gtgctggccgacgcctatggcgctcacagcagcgtgcccggctacgcctcggtgccctac
tacccgcgagacgagcagcagcgcgagcgcgaccacatgttcgactggcacctggcccag
gaggtgcagcccggctcgctggagctcaacgactatgatttccagcgccccagcgcccgg
atcgacgtgcgctcggccatgccgcggccccacagcgccggcgactacccgctctacgac
taccccggcacctacgtgcagagcagcgacggcgagcactatgcccagacccgcatcgag
gccctgcaaagcctgcatgagcgcatcgagctcagcggcaacgcccgggggttgggggtg
ggcaacctgttcagcctcaccggcttcagccgccaggaccagaaccgcgaatacctgatc
gtcagcatccgctactacctggtccaggaaagcctggagagcggcgctggcggcggctcg
gcgcagttcgagagccacctgacctgcatcgacgcccagcagagcttccgccccctggcc
accacccacaagcccatggtccagggcccgcagaccgcgcgagtggtgggcccggccggg
gaagagatctggaccgaccagtacggccgggtcaaggtgcacttccactgggaccgccac
gaccagtccaacgaaaacagctcgtgctggattcgcgtgtcccaggcctgggccgggaag
aactggggctcgatgcagatcccgcgcatcggccaggaagtcatcgtcagcttcctggaa
ggcgatcccgatcgcccgatcatcaccggccgggtctacaacgccgaacagaccgtgccc
tacgacctgcccgccaacgccacccagagcggcatgaagagccgttcgagcaagggcggc
agcccggccaacttcaatgaaatccgcatggaagacaaaaagggcgcggagcagctgtac
atccacgccgagcgcaaccaggacatcgtggtcgaggtcaacgaaagccattcggtgggc
aacaaccgcaacaagagcatcggccacgacgagtacgtgaccatcggcaacaagcgcacg
cgcatcgtccagcacgtggatgagctgcgggtcggcgagaagaagctcgacagcgtcggc
cagagctatgtgatcgaggtcggcgagcgcctgcgcctggtatgcggggccagcatccta
gagctcaacgccagcggccagatcaacctgtgcggggtcaacatcagcgtgcatgcctcg
gccgatgcccagatcaataccggtggcgtgctgcacctgaacaacggcggcggcccgggc
accaccaccgagggccagggtgtgcagggcgccatcagcgccaaggccaaagcccccttt
tccgcccccaaaggctaa

DBGET integrated database retrieval system