KEGG   Pseudomonas protegens Pf-5: PFL_6095
Entry
PFL_6095          CDS       T00249                                 

Name
(GenBank) conserved hypothetical protein
Organism
pfl  Pseudomonas protegens Pf-5
SSDB
Motif
Pfam: DcrB YlqD
Other DBs
NCBI-ProteinID: AAY95283
UniProt: Q4K3N0
Position
6924978..6925403
AA seq 141 aa
MTYRLNELQFQLPAGELQDASINILKFPALGTSLIVSRSLLGDGETLESNLASQLQRLEQ
QVQDLRCQAPQPVQLGPAQDIQGLELRSQFNKGKEQVFQFQLALVLPGTRQMLAMSYVKA
QKLGDAEAAHWAQIKNTLVLG
NT seq 426 nt   +upstreamnt  +downstreamnt
atgacctatcgcctcaatgaattgcagttccaactgcctgccggcgaactgcaggacgcc
tcgatcaacatcctcaagttcccggccttgggcacttcgctgatcgtcagccgcagcctg
ctgggggacggcgaaaccctggagagcaacctggccagccagctgcagcggctggagcag
caagtccaggacctgcgctgccaggctccgcaaccggtgcagctgggcccggcccaggac
atccagggcctggagctgcgcagccagttcaacaagggcaaagaacaggtgttccagttc
cagctggccctggtgctgcccggcacccgacagatgctcgccatgagctacgtcaaggca
cagaagctcggcgacgcggaagccgcccattgggcgcagatcaagaacaccctggtgctg
ggctga

DBGET integrated database retrieval system