KEGG   Pseudomonas protegens Pf-5: PFL_6096
Entry
PFL_6096          CDS       T00249                                 

Definition
(GenBank) Rhs family protein
Organism
pfl  Pseudomonas protegens Pf-5
SSDB
Motif
Pfam: RHS_repeat RHS PAAR_motif
Other DBs
NCBI-ProteinID: AAY95284
UniProt: Q4K3M9
Position
6925413..6929873
AA seq 1486 aa
MSDALWAARLGDGLEHTSMMADILGGVLEVAANVAIGALATMAVAAAAGITVATGGLGAC
VLGLVVGVVVGVVMSKTGADKGLSNLCEGIANALFPPSIQATIASGSKKVLTNNKPAARA
AGIAPPTQISGDGAEEGEATDTPSATPEEGPGFLDMAKEFFSQMWRPTVASPAPGSQTKE
LDLVTCTKHPPMPVQYLAEGSEKVSIDGQPAVRSGDRSTCDAKVVSAGPISPNVTIGGGS
VVVREIRSGKTPGVGLAVTVLMMLKGGKGKFLSNLPCMLMAGVNSFVVSQATNALTQAVV
ASTHPVHAATGAKVLGADDDLDFTLPGLMPIEWQRFYNSRDERRDGLLGAGWSLPYEISV
QIEPHPEGGERLLYIDEQGRRIDMGSIALGAGAFSPGEGLSVRRNENGQLLIESSDGIYR
LFEPLPGDSSRLRLSLLGDRNDNRLHLEYDSSGRLWLLRDTFEQAQLELSYSTLWPGRIA
QVERLYPDQQREVLVSYDYDAAGDLAQVRDSEGQVQRRFAYDAGHRMIEHQLATGLRCFY
QWTQFADQQWRVTRHWTDEGDSYQYDYDLEAGITQVTDSLQRLSRRRWNSQLQIVEYTDN
LNQTWAFEWNDERQLLSATDPLGGRYAYSYDETGNLIAETDPLGHSHSTLWLEHWSLPQT
LTDPAGESWHLRYDPRGNCIAEVDPLGQVTQYRHDAHGQVVEIIDAAGRSRKMRWNSSGQ
LLEHLDCSGYPTRFEYDRRGNVKAIIDALGEHTRFHYDCQGRLLSSQLADGRAEHFQRSS
NGQLQGYTDPSGYTTLYQYNRRGQIRQRIDAHGRQVRFDYDAYGRLLALTNENGESYRFA
WDAGNRLSEQQDLDGSAKRYGYDLLNNVVELQSHPAPYGTGLSAVPAQPIAPIIHRFERD
AVGRLLAKITDDGRSQYTYDPLNQLTAASFTDNLGNQQALSFSYDALGQLLEEHTVAGSL
IHRYDELGNLTQTQLPDKRWLNRLYYGSGHLHQINLDGQVVSDFQRDRLHREVLRTQGQI
STRSEYDRCGRLRARLQHSSLLANTLPTAPERHLEYDDSDNLVGLAERHATGQHRQLFHY
DATGRIIASQDGLQGQKETFAYDAAANLLDGPKAGAGLVVHNKLLTYQDKRYRYDAFGRM
IEKRSGRRGVQRFAYDAEHRLIEVRNQTSSGETLVRMRYDVLGRRISKSEYDSQGNLLGE
TRFVWDGLRLLQEQRNQQTSLYVYEDLGHAPLARVDGLGAQQKIRYYHNDLNGLPQQLCE
PDGHSVWQARYQVWGNTVEEIREPYYIEEQNLRFQGQYLDRETGLHFNTFRFYDPDIGRF
TTPDPIGLAGGLNLYQYAPNPIGWIDPLGWICKSAYSGRRGTTKAKADLERNGFTVVGEE
LTMKVKHPVTQKSYRIRADIIAKDKAGNYHVFEVKNGSGKLTKNQQGSGMFDMSNPANTN
GGLGGGLIKPSGATQGQFEVATKTARGTQFGGNGAQHSATFWLLRY
NT seq 4461 nt   +upstreamnt  +downstreamnt
atgtctgacgcactgtgggccgcccgcctgggtgacgggctggaacacacctcgatgatg
gccgacattctcggcggtgtgctggaggtggcggccaacgttgccatcggcgccctggcg
accatggcagtagccgcggcggcaggcatcaccgtggccaccggcggcctcggcgcctgt
gtgctggggctggtggtgggcgtcgtcgtcggcgtggtcatgagcaagaccggagccgac
aagggcctgagcaatttatgcgagggtatcgccaacgccctgttcccgccctcgatccag
gccaccatcgccagcggctcgaaaaaggtcctgaccaacaacaagccggcggcccgcgcg
gccggcatcgcaccgccgacacagatcagcggcgacggcgccgaagaaggcgaagccacc
gacaccccgtcggcaacgcccgaggaagggcccggtttcctcgacatggccaaggagttt
ttctcgcagatgtggcggcccaccgtggcctccccggcgccaggctcccagaccaaggaa
ctggacctggtgacctgcaccaagcacccgccgatgccggtgcagtatctggctgaaggc
tcggaaaaggtcagcatcgacggccagccggcagtacgcagcggcgaccgcagcacctgc
gatgccaaggtagtgtcggccgggcctatctccccgaacgtgaccatcggcggtggctcg
gtggtggtgcgcgagatccgtagcggcaagaccccgggggtgggcctggcggtgaccgtg
ctgatgatgctcaagggcggcaagggcaagttcctcagcaacctgccgtgcatgctgatg
gccggggtcaattcctttgtcgtcagccaggccaccaatgctttgacccaggccgtcgtc
gcctcgacccacccggtgcatgcagccaccggggccaaggtgctcggagccgacgacgat
ctggatttcaccctgcccgggctgatgcccatcgaatggcaacgcttctacaacagccgc
gacgaacgtcgtgacggcctgctcggggccggctggagcttgccttacgagatcagcgtc
cagatcgagccccaccccgaaggtggcgagcgtctgctctacattgatgagcaaggacgc
cgcatcgacatgggctccattgccctgggtgcaggagccttcagccccggtgaaggcttg
agcgtgcgacgcaacgagaacggacagttgctgatcgaaagcagcgacggtatctaccgt
ctgttcgagccgctgccgggcgactcctcgcggctgcgcctgagcctgctgggggaccgc
aacgacaaccgtctgcacctggagtacgactcgtccggacgcctctggctgctgcgtgac
acctttgaacaggcgcagctcgaactgagctacagcacgctctggcccggtcggattgcc
caggtcgaacggctgtaccccgaccagcaacgggaagtgctggtcagctatgactacgat
gcggcaggagacctggcacaggtgcgcgatagcgaaggccaggtacagcgtcgcttcgct
tatgacgccggccaccggatgatcgaacatcaattggccaccgggctgcgctgcttctat
caatggacacaatttgccgaccagcagtggcgagtgacccgtcactggaccgacgaaggc
gatagctatcagtacgactatgatctggaggcgggaatcacccaggtcaccgacagcctg
caacgcctcagccgccgccgctggaacagccagttgcagatcgtcgagtacaccgacaac
ctcaaccagacatgggccttcgagtggaacgatgagcgccaactgctcagcgccaccgac
cccttgggagggcgctatgcctatagctacgacgaaaccggcaacctgatagccgagacc
gatcctctggggcacagccattcgaccttgtggctggagcactggtcgctgccacagacc
ctgaccgatcccgccggagaaagctggcacctgcgctacgatccccggggcaactgtatc
gccgaagtagacccgctgggccaggtgacccagtaccgccatgacgcgcacggccaggtg
gtggagatcatcgatgccgcgggaagaagccggaagatgcgctggaactcgtccgggcaa
ttgcttgaacacctggactgctcgggctatccaacccgcttcgaatacgatcgacgcggc
aacgtgaaagccatcatcgatgcccttggcgagcacacccggttccattacgactgccag
ggacggttgctgagcagccaactggccgatgggcgcgccgagcattttcaacgcagcagc
aacggccagctacagggctacaccgacccttccggctacaccacgctctaccagtacaac
cggcgcgggcagatacgccagcgcatcgacgctcacggccgacaggtccggttcgactat
gacgcgtacggacggctgctggcgctcaccaacgagaacggcgaaagctatcgctttgcc
tgggacgccggcaaccgcctgagcgaacagcaggacctcgacggcagtgccaaacgctat
ggctatgacctgctgaacaacgtcgtcgaactccagtcccaccccgccccttatggcacc
gggctgagcgccgtgcccgcgcaacctatcgcgccgatcatccaccggttcgagcgcgat
gccgtggggcggctgctggccaaaatcacagacgatggccgcagccaatacacctacgac
cccttgaaccaactgaccgccgccagctttaccgacaacctcggcaaccagcaggcactg
agtttcagctacgacgccctgggccaattactcgaagaacacaccgtggccggcagcctg
atccatcgatacgacgaactgggcaatttgactcagacccagctaccggacaagcgttgg
ctcaaccggctctattacggcagcggccatctgcaccagatcaatctcgatggccaggta
gtcagcgactttcaacgtgaccgcctgcaccgtgaggtgctgcgcacccagggtcagatc
agcactcgcagcgaatacgaccggtgtggccgcctgcgcgcacgcctgcagcattccagc
ctgctggcaaacaccttgccaacagccccggagcgacacctggagtacgacgatagcgat
aatctggtgggcctggccgagcgacatgccaccgggcaacatcggcaactgttccattac
gacgcgaccgggcgaatcattgccagccaggacggcctgcagggccagaaagaaaccttc
gcctatgacgccgccgccaatttgcttgatggcccgaaggcgggcgccgggctggtggtg
cacaacaaattgctgacctaccaggacaagcgctaccgctacgatgccttcgggcgaatg
attgaaaaacgcagtggtcggcgaggcgtgcaacgttttgcctacgacgccgaacaccgg
ttgatcgaagtgcgcaatcagacctccagcggcgaaaccctggtcaggatgcgctacgac
gtcttgggtcgccgcatcagcaagagcgagtacgacagccagggcaaccttctgggtgaa
acgcgattcgtctgggatggcctgcggctgctgcaggaacagcgtaatcaacagaccagc
ctctatgtctatgaagacctgggacatgcgcccctggcgcgggtcgacggccttggcgcg
cagcagaagatccgctactaccacaacgacctgaatggcctgcctcaacagctttgcgag
cctgacggccatagcgtctggcaggcccgctatcaggtctggggcaatactgtcgaagaa
atacgcgagccctactacatcgaggaacagaatctcaggttccagggccagtacctggac
cgcgagactggattgcacttcaacacgttccgtttctacgacccggatatcgggcgcttc
accacgccggaccccatcggcctggccggaggcttgaacctttatcagtacgctcccaac
ccaatcggttggatcgatccgctgggctggatctgcaaatcggcctacagcggcagaagg
ggcactacaaaagccaaagctgacctcgagaggaacggtttcactgtggtaggtgaagaa
ttgaccatgaaggtcaaacaccctgtcacccagaagtcctatcgcatcagggcagatatc
atcgccaaggacaaagccggcaactaccacgtgttcgaagtcaaaaatggcagcggcaaa
ctgaccaagaaccaacagggatcgggaatgttcgacatgagcaatccggccaatactaac
ggtggcctgggcggtggcctgatcaaaccgtcgggcgctacccaaggccagttcgaagtt
gcgaccaaaaccgccagaggtacccagttcggtggcaatggcgcacagcattcggccacc
ttctggcttcttcgctattga

DBGET integrated database retrieval system