KEGG   Pseudomonas protegens Pf-5: PFL_6099
Entry
PFL_6099          CDS       T00249                                 

Name
(GenBank) conserved hypothetical protein
Organism
pfl  Pseudomonas protegens Pf-5
SSDB
Motif
Pfam: DcrB PsbP_2 Lpp-LpqN
Other DBs
NCBI-ProteinID: AAY95287
UniProt: Q4K3M6
Position
complement(6930853..6931287)
AA seq 144 aa
MSTYRIQEADLDIPDAWQDQSINIFKLPAVGGAQEASFVISRDPSQGDAAFADYVAAQLN
AAEQQLPGFNLIKRWDFDMQGHAAVLLDYSWKREGRELMLRQVFIERKPAVLITTLTTTV
NDLVHHEPAWKQAMQSLKPQPSKA
NT seq 435 nt   +upstreamnt  +downstreamnt
ttgtccacctaccgcattcaagaagccgatctcgatattcctgacgcctggcaggaccag
agcatcaatatcttcaagctgccagccgttggcggtgcccaggaagccagcttcgtcatc
agccgcgacccgagccagggcgacgccgcctttgccgattatgtcgccgcgcagctgaat
gctgccgagcagcaactgccaggtttcaacctgatcaagcgctgggacttcgacatgcag
ggccatgccgccgtgctgctggactacagctggaaacgcgaagggcgcgagctgatgctg
cgccaggtcttcatcgagcgtaagccggccgtgctgatcaccaccctgaccaccacggtc
aacgacctggtgcatcatgagccggcctggaaacaggccatgcagagcctcaagccgcag
ccttcgaaagcctga

DBGET integrated database retrieval system