KEGG   Pseudomonas protegens Pf-5: PFL_6122Help
Entry
PFL_6122          CDS       T00249                                 

Definition
(GenBank) aldose 1-epimerase family protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00010  Glycolysis / Gluconeogenesis
pfl01100  Metabolic pathways
pfl01110  Biosynthesis of secondary metabolites
pfl01120  Microbial metabolism in diverse environments
pfl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFL_6122
Enzymes [BR:pfl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PFL_6122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim MBD
Motif
Other DBs
NCBI-ProteinID: AAY95310
UniProt: Q4K3K3
Position
6952965..6953864
Genome map
AA seq 299 aa AA seqDB search
MPTPQVETVKLDELNCWRIRHGDAELLVAQQGAHILSYQVAGQQPLIWLNDEAVFKRGKS
IRAGVPVCWPWFGNFARNPQAVQAMRQGTDPAPAHGLVRATDWELLGIESQGDSLLVELR
LPCPAGGFPGWPHQVEPRLSIRLDQQLHISLSSHNLGTESVSISQALHSYFAVSDVRQVQ
VEGVDGLSYIETLEDWKTKVQSGSLHFTGETDRIYLNAPTQLEIVDPDWQRRIRLRSEGS
RTAVIWNPWIDRAAQFSDMADDGWQRMLCIETANVMDDIVTLAPGASHTLSVSISAAPL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcctacgccccaggtcgaaacggtaaaactggatgaactgaactgctggcgcatccgc
cacggtgacgccgaactgctggtggcccagcagggcgcgcacatcctcagttatcaagtg
gccgggcaacagccgctgatctggctcaacgacgaggccgtgttcaagcgcggcaagagc
atccgcgccggggtgccggtgtgctggccctggttcggcaactttgcccgcaacccgcag
gcggtgcaggccatgcgccaaggcactgacccggcgccggcccacggcctggtgcgggcc
actgactgggaactgctgggcatcgaaagccagggtgacagcctgctggtggagctgcgc
ctgccctgccccgcgggtggttttcccggctggccccatcaagtggaaccgcgcctgagc
atccgcctcgaccagcaactgcacatcagcctcagcagccacaacctgggcactgaaagc
gtgagcatcagccaggcgctgcacagctacttcgcggtcagcgatgtgcgccaggtgcag
gtcgaaggcgtggacgggctgagctacatcgaaaccctggaagactggaagaccaaggtc
cagagcggcagcctgcactttaccggcgagaccgaccgcatctacctgaacgccccgacg
cagctggagatcgtcgatccggactggcaacgacggatccgcctgcgcagcgaaggctcg
cgcaccgcggtgatctggaacccctggatcgaccgcgccgcccaattcagcgacatggcc
gacgacggctggcagcgcatgctgtgcatcgagaccgccaacgtgatggacgacatcgtc
accctggccccgggcgccagccacaccctgagcgtcagcatcagcgccgccccgctctga

DBGET integrated database retrieval system