KEGG   Pseudomonas protegens Pf-5: PFL_6209
Entry
PFL_6209          CDS       T00249                                 

Name
(GenBank) PAAR motif containing protein
Organism
pfl  Pseudomonas protegens Pf-5
SSDB
Motif
Pfam: PAAR_motif
Other DBs
NCBI-ProteinID: AAY95397
UniProt: Q4K3B6
Structure
Position
7049182..7050408
AA seq 408 aa
MDVQAAARLGDDIAHGFGVAAMLTGAVAGALIGAAIIAATAATGGLAVVILAGSVAAGGL
SMFQLVKGLSTIFDLPEPTTGELIRGSPNVFVNLRNAMRAGEDVSSSCTGFPVAHPPWPF
PVTIAEGSATVYINGKPAARLSSKMTCGAHIKSGSPNTFIGGPTLQVEFVLDIEGWLHTG
LEALGLVAAAGALVLAAMAGLAALLTTVAVGAAIYGGMELLGQLGDRLGPGYRDLLQGIA
GLALLGAGPKMAKLSAERNAARLANQSQVLEVRTAAQVNEAMVAEGNLPAWLEGTQVKTE
IVPPGRQYQMVVAKGQAEAIMQGKPAFGGFAAPEPIPSQAYARDKLVILDRFKTDVSHVI
TVETTAPQKIHSGITGPLENYKGGVQQVEFVGDRNLKIVGTPGVLPVE
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggatgtacaggccgcagcgcggttgggcgacgacatcgcccatggattcggagttgct
gccatgctcaccggcgcggtcgcaggcgctctcattggcgcggccatcattgcggcgacc
gcggcaacaggcggcctggcggtggtgatcctggcgggttcggtcgccgccggtggcctg
tcgatgttccagctggtgaaggggctgtcgaccatcttcgatctgcccgagccaaccacc
ggtgaactcataaggggcagtcccaacgtattcgtcaacttgcgcaatgccatgcgtgcc
ggcgaggacgtgtccagttcctgtaccggctttcccgtggcgcatcccccctggcccttc
ccggtcaccatcgccgaaggcagcgctaccgtgtatatcaacggcaagccggcggcgcga
ctgagcagcaagatgacctgcggcgcgcatatcaagtccggtagcccgaacaccttcatc
ggcggtccgacgctgcaggtggaattcgtgctggatatcgagggctggctgcataccggc
ctggaggcgctgggcctggtcgccgccgccggcgcgctggtgctggccgccatggccggc
ctcgcggccctgctgaccaccgtggcggtgggggccgcgatctatggcggcatggagttg
ctgggccagctcggcgaccggctcggcccgggctaccgcgacctgctgcaaggtatcgcc
ggcctggcgctgctcggcgccgggccgaaaatggccaagttgagcgccgaacgcaatgct
gcgcgactggccaaccagtcgcaggtgctcgaggtgcgcacggccgcccaggtcaacgag
gcgatggtcgccgagggcaacttgccggcttggctggaaggcacccaggtcaagaccgaa
atagtgccaccgggaaggcaataccagatggtcgtcgccaagggccaggccgaagccatc
atgcagggcaagccagccttcggaggtttcgccgcccccgagccgattcccagccaggcc
tacgctcgggataaactggtgatcctcgatcgattcaagacagacgtatcccatgtgatc
accgtcgaaaccaccgcaccgcaaaagattcacagtggtatcaccggcccgctggagaac
tacaagggcggcgtgcagcaggtggagttcgtcggtgacaggaatctgaaaattgtcggc
acgcctggtgtgctgcctgtggagtga

DBGET integrated database retrieval system