KEGG   Pyrolobus fumarii: Pyrfu_0006Help
Entry
Pyrfu_0006        CDS       T01620                                 

Definition
(GenBank) NADH ubiquinone oxidoreductase 20 kDa subunit
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_q6
Motif
Other DBs
NCBI-ProteinID: AEM37878
UniProt: G0EDP1
Position
complement(5026..5424)
Genome map
AA seq 132 aa AA seqDB search
MAKALLRCRRCLELFEIVYWPMLVEETRLPTGVDVVLVTGFAGSIEDVERLRKIMHGVKL
LVSVGCCALNGGVFAVRGLRVVPPAVLQPKGTPLVRVPGCPPQLEMLETILSRVAVQLGR
DVETEGGMSSRR
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaggcgttgttaaggtgccgacggtgcctggaactcttcgagattgtatactgg
cctatgctggttgaagagacgaggctcccaacgggggttgatgtagtacttgtgacgggc
tttgcaggtagtatagaggatgtagagcggctcagaaagataatgcatggcgtgaagctt
ctagtgagtgtgggttgctgtgcgttaaacggtggagtgtttgcagttcgaggcctgagg
gttgtgccgccagccgtcttgcagcctaagggtaccccgctcgtgagggtacctggatgc
cctcctcaactagagatgctcgaaacgatattatcgagagtggcggtgcagctaggcagg
gatgtggagaccgaggggggtatgagctctcggcgatga

DBGET integrated database retrieval system