KEGG   Pyrolobus fumarii: Pyrfu_0008Help
Entry
Pyrfu_0008        CDS       T01620                                 

Definition
(GenBank) Xylose isomerase domain-containing protein TIM barrel
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 LamB_YcsF
Motif
Other DBs
NCBI-ProteinID: AEM37880
UniProt: G0EDP3
Position
complement(6246..7142)
Genome map
AA seq 298 aa AA seqDB search
MTALMPVLFDWGTYNSASTLEKAALLGMKLTELPPYDLTRRYYGDEYFQGYAREARQAFT
TITAHGPYYNVVAKRPETQAKVVKAFREAARRAVLAGAEIFNIHLGWRIYYDDRDIDAAA
EVVKAILDVLPSNVYLSLEVTYTRHQLGTFEDIRAIMEKVGDPRLTISNQLENSFILLTR
VYETGDFVGADSIVDKSFWLRVLEETERLSRGYFSLRFSQVTGVYFGGRLLKKRTPLGTG
YPRLEPLAEALAEYLVRLQRRRPGELKVHIIYTGPWQTKFRDAIRLYSEIAMRASELL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgctaatgccagtactcttcgactggggcacttataactcagcctccacgctc
gagaaggctgcgctactgggtatgaagcttaccgagctgcccccctacgacctaaccagg
aggtattatggcgacgagtacttccagggttacgcgagggaggcgcgccaagccttcacg
acgataacggctcacgggccctactacaacgttgtggccaagaggccggagacacaagcc
aaggtggttaaggccttccgcgaggccgctaggagagccgtactagccggtgccgagata
ttcaacatacacctaggctggaggatatactatgacgaccgtgatatcgatgcagccgcg
gaggttgtcaaggctatactcgacgtgttgcctagcaatgtctacctcagccttgaggtg
acatacacaaggcaccagctaggcacttttgaagacataagggctatcatggagaaggtt
ggtgacccgaggctcaccataagtaatcagctggagaacagcttcatactcttgactcgc
gtctacgagactggcgatttcgtaggcgcggacagcattgttgacaagagcttctggctc
cgtgtcctcgaggagacagagaggctctcgagaggctactttagtctacgcttcagccag
gtgaccggcgtctacttcggcggacggttgctcaagaagaggacacccctggggaccggc
tacccgaggctagagcccctagccgaggctctagcagagtacctggttcggctgcaaaga
aggcgtccaggcgaactaaaggtgcacataatctacactggtccctggcagacgaagttc
cgtgacgcaatacgcctatactccgagatagcaatgagagcctctgagctcctctag

DBGET integrated database retrieval system