KEGG   Pyrolobus fumarii: Pyrfu_0014Help
Entry
Pyrfu_0014        CDS       T01620                                 

Definition
(GenBank) protein of unknown function DUF1028
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1028 DUF3731
Motif
Other DBs
NCBI-ProteinID: AEM37886
UniProt: G0EDP9
Position
complement(11931..12557)
Genome map
AA seq 208 aa AA seqDB search
MTYSILAYDPAAGQAGVAVVSGSIAVGSRVPWGRHGVGVVATQGYTNPALGPLILELLAK
GYTASDAIVKALAGDTSPAHRQLAVVDYRGDVAVHDGEWTPAWHGYRMAARESAVAIANL
VVGPRVVEAMIEAFESTRGTLAERLLAAIEAGHRAGGDRRGDRSAALLVVGATEYGPHYD
KIVDLRVDFHSHDPVSELIKLYEYYLER
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacatatagtatacttgcgtacgaccctgctgctggtcaggcgggtgtcgcggtggtc
agtggtagcattgctgtgggtagtcgtgtgccgtggggtaggcatggtgttggtgttgtc
gctacgcaggggtataccaatccggctctagggccgctcatactcgaactgctcgccaag
ggttataccgcgtctgacgcgatagtcaaggctcttgcgggtgacacgagcccggcgcac
aggcaactcgcggtggtagactataggggcgatgtggcggtacatgatggtgagtggacc
ccagcctggcacggttacaggatggctgcgagggaatcagccgtagcgatagcaaacctt
gtcgttgggccccgtgtcgtggaggcgatgatagaagccttcgagtcgacgcgtggcacg
ctagctgagaggctcctcgcggcaatagaggcgggccaccgtgcgggcggggataggaga
ggtgaccgttctgcagcgcttctagtcgtaggcgctaccgagtacggaccccattacgac
aagatagttgacttgcgtgtagacttccactcgcacgacccggtatcagagctcataaag
ctttacgagtactacctggagcgttga

DBGET integrated database retrieval system