KEGG   Pyrolobus fumarii: Pyrfu_0017Help
Entry
Pyrfu_0017        CDS       T01620                                 

Definition
(GenBank) Methyltransferase type 11
  KO
K07442  tRNA (adenine57-N1/adenine58-N1)-methyltransferase catalytic subunit [EC:2.1.1.219 2.1.1.220]
Organism
pfm  Pyrolobus fumarii
Brite
KEGG Orthology (KO) [BR:pfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pfm03016]
    Pyrfu_0017
Enzymes [BR:pfm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.219  tRNA (adenine57-N1/adenine58-N1)-methyltransferase
     Pyrfu_0017
    2.1.1.220  tRNA (adenine58-N1)-methyltransferase
     Pyrfu_0017
Transfer RNA biogenesis [BR:pfm03016]
 Eukaryotic Type
  tRNA modification factors
   Methyltransferases
    Pyrfu_0017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCD14 Methyltransf_31 PCMT Methyltransf_25 Methyltransf_11 MTS Ubie_methyltran Methyltransf_24 GCD14_N Methyltransf_18 Methyltransf_3 Methyltransf_12 PrmA UPF0020 Methyltr_RsmB-F Methyltransf_23 Methyltransf_32 Met_10 US22 RrnaAD Cons_hypoth95
Motif
Other DBs
NCBI-ProteinID: AEM37889
UniProt: G0EDQ2
Position
14223..15020
Genome map
AA seq 265 aa AA seqDB search
MTCTLKEGDLVVIEFDERRRFVTRLRKGARTGSDVGVVLHDDVIGSPCGSYVPVRGGRGG
YALVYKPSIIDVLEHGFRRATQVIYPKDSALIAVLAGVGPGARIVEVGTGSGFVTALLAW
LVGENGHVYTYEVRREALETAKRNLAMLGLEKRVTFHHRDARLGILEENVDAVIVDMPDP
WDILDEAYRALKPGGVFAAYTPSAHQLYMLMERLLEHGGFTRPRVMEVLLREWLPEPEAL
RPASTMIAHTGFITVSRKVTKKEQV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgacatgcacgctcaaagagggtgacctggtggtaatagagtttgacgagagacgccgc
ttcgtgacgaggctgcggaagggtgcacgcaccggcagcgacgttggcgtggttcttcat
gatgatgttatagggtctccttgcgggtcttacgtgcccgtgcgtggcggtagaggcggt
tatgcactggtatacaagccgagcataatcgatgtacttgagcacggcttccggcgtgct
actcaagtgatatacccgaaggattctgcattgatagccgtgcttgcaggcgttggcccc
ggtgctcgtatcgtagaggttggcaccgggtctggcttcgtcacagcacttctggcctgg
cttgtcggtgagaatggacacgtgtatacttacgaggtccggagggaggccctggagacc
gcaaagaggaacctcgctatgctcggtttggagaaacgcgtgactttccaccatagagac
gctaggctgggcatactggaggagaatgtggatgccgtgatcgtcgatatgccggacccc
tgggatatacttgacgaggcttacagggctttgaagccaggaggcgtatttgcagcctac
acgccaagcgcgcaccagctctacatgctcatggagaggttattagagcatggcgggttt
acaagaccgcgtgttatggaggtgcttttgagggaatggctgccggagccagaggcacta
cgaccagcatcaaccatgatagcgcacacaggattcataacagtctcgaggaaggtaacc
aaaaaggaacaagtctag

DBGET integrated database retrieval system