KEGG   Pyrolobus fumarii: Pyrfu_0023Help
Entry
Pyrfu_0023        CDS       T01620                                 

Definition
(GenBank) thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
pfm  Pyrolobus fumarii
Pathway
pfm00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:pfm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Pyrfu_0023
Enzymes [BR:pfm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     Pyrfu_0023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_oxidored FAD_binding_2 GIDA Thi4 FAD_binding_3 K_oxygenase HI0933_like NAD_binding_8 NAD_binding_7 DAO Trp_halogenase AlaDh_PNT_C Lycopene_cycl Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AEM37895
UniProt: G0EDX9
Position
complement(18338..19339)
Genome map
AA seq 333 aa AA seqDB search
MSFRLATTPFSKRRMAEIARKVYDVVIVGGGPAGLTAAIYAARYMLDTILVTEEIGGQIA
EAGWVENYPGFPRILGSELVKRFVDHVRHYKVPIILDYVENVKRDADCDCFHVETRRGVT
YKSHTVILAVGVKRRRLNVPGEAELRGKGVSYCAPCDAPLFKDKTVAVVGGGDSAASAAL
LLAEYASKVYIVHRRDKLRVQPIYEKLLRENPKIEVVYNKVVQRIIGSNRVEGIELRDRV
TGETSVLRVDGVFVEIGSEPPKELAQRIGLETDEEGYIKVGPDQSTNIPGIFAAGDCTTA
MNKYRQVITAAAQGAVAAASAYNYLVRKGIKGK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
ttgagctttcgtctcgcaactacaccattctcgaagcgccgcatggctgagatagcgcgt
aaggtatacgacgtagttattgtgggcgggggtccggcgggcctcacggctgcgatatac
gctgctaggtacatgctcgatacgatactggtcaccgaggagataggagggcagatagca
gaagcggggtgggtggagaactacccagggttcccgaggatacttggctccgagcttgta
aagaggttcgttgatcatgtgcgtcactacaaggtgccgattatactcgactacgtggag
aatgtgaagagggacgctgactgcgactgttttcatgttgagacgcgacgtggcgtaacg
tacaagagtcacacggtcatactcgctgtcggtgttaagcgaagaaggttgaatgtgccg
ggagaggcagagcttagaggtaaaggcgtcagttactgtgctccttgcgacgcgcccctc
ttcaaggacaagactgtagctgttgttggtgggggtgactctgcagctagtgcggcgcta
ctcctcgcagagtacgcctccaaggtttacatcgtgcacaggagggataagctacgtgtc
caaccgatatacgagaagctgttgcgtgaaaacccgaagatcgaagtagtgtacaacaag
gtcgttcagaggataatcgggagtaaccgtgttgaaggcatagagcttcgcgaccgtgta
accggggagactagcgtgttacgcgtagacggcgtgttcgtcgagataggctcggagcct
ccgaaggagcttgcccagcgcattggactcgagacagacgaggagggttacatcaaggtt
ggtccagaccagtctacaaacattcccggtatattcgctgctggtgactgtacaactgct
atgaacaagtataggcaggtgataacggcggctgctcagggtgccgttgcagcagcatct
gcctataactacctggtgagaaagggtattaagggtaaatag

DBGET integrated database retrieval system