KEGG   Pyrolobus fumarii: Pyrfu_0024Help
Entry
Pyrfu_0024        CDS       T01620                                 

Definition
(GenBank) hypothetical protein
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4423 TrmB HTH_9 ANAPC2 Penicillinase_R HTH_5 GntR PaaX Peptidase_S80 HTH_20 Glyco_trans_1_2 DUF4258
Motif
Other DBs
NCBI-ProteinID: AEM37896
UniProt: G0EDY0
Position
complement(19413..19730)
Genome map
AA seq 105 aa AA seqDB search
MDEAKRGRVEPLSGGKDVVVYNKNIVLEKLYEDDELVVVVAPNEDQLRDILIRLLNEGPK
TVKELHSMLSGLASEDKIRRALAELVEEGIVVSDNDGRYYIASPY
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
ttggacgaggccaagcggggccgggtggagcccttgagtggcggcaaggatgtagttgtt
tacaacaagaatattgtactcgagaagctgtatgaggatgacgagcttgtggttgtagtg
gctccgaatgaggaccagttgcgtgatatactcatccggcttctaaacgaggggcccaag
actgtgaaggagctgcactccatgctctctgggcttgcaagcgaggataagatccgtcgt
gcgctagccgagcttgtagaggaaggtatcgttgtaagcgataacgatgggcgttactac
atagcatccccgtactag

DBGET integrated database retrieval system