KEGG   Pyrolobus fumarii: Pyrfu_0026Help
Entry
Pyrfu_0026        CDS       T01620                                 

Definition
(GenBank) peptidase M24
  KO
K01271  Xaa-Pro dipeptidase [EC:3.4.13.9]
Organism
pfm  Pyrolobus fumarii
Brite
KEGG Orthology (KO) [BR:pfm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pfm01002]
    Pyrfu_0026
Enzymes [BR:pfm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.9  Xaa-Pro dipeptidase
     Pyrfu_0026
Peptidases [BR:pfm01002]
 Metallo Peptidases
  Family M24
   Pyrfu_0026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M24 Creatinase_N
Motif
Other DBs
NCBI-ProteinID: AEM37898
UniProt: G0EDY2
Position
complement(20292..21410)
Genome map
AA seq 372 aa AA seqDB search
MQGENNLGKLRRVLEAKELDALVILDPGFASWALGAPRSIFGGGGIAVLFDDSGVSVVTH
LLEFWRISDKLQGVEVYVYTRRADDEVVEPGRIVGPNLKDALVRLLGEGKRVGCDRSACT
QLQGVKGVEALDVTSDLWSLRMVKEDWELRRMVEALDIAERALRKTMAMLSEGITELEVA
GEHERILRIYGSETHAFATHGSLTIVAFGANTAYPHWDPSDRRLTGNEPVLIDTGAVKRG
YCSDVTRVTWYPAGSGPREWRELVERVVAAVGEAIDRVEPGIEASVVDEVARRALGPYAK
WFIHSTGHGIGVEVHEPPRVAPGEKTRLEKGMVFTIEPGVYLRGRFGVRIEQMVVVDSRG
ARVLNKLPMTLE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaggcgagaacaatcttggaaaactacggagagtcctcgaggctaaggagcttgat
gcgctggtaatcctcgatcctggttttgcctcgtgggcgctgggcgcgcctcgtagcata
ttcggtggcggtggtatagcggtcttgttcgacgatagtggggttagtgtcgtcacacac
ctcctggaattctggaggattagtgacaagctccaaggagttgaggtgtatgtatacacg
agacgcgcggatgacgaggtagtagagccgggcaggattgtaggccctaatctcaaggat
gcgcttgtacgtctactgggggagggtaaaagggtcggttgtgatcgctcggcttgcact
caactccagggtgttaaaggtgtagaggcactcgatgtgacgagtgacctgtggagtctt
cgcatggttaaggaggattgggagttaagacgtatggttgaagcgctggatatcgctgag
agagcactccgcaagaccatggcgatgttgagcgagggtatcacggagctagaggtggcc
ggcgaacatgagaggatactgcgcatctatggctcagagactcacgcgttcgctacacac
gggtctctcaccatagtcgcgtttggggcaaacactgcctatcctcactgggatcccagc
gacaggaggctcaccgggaacgagccggtgctgattgatactggcgcggttaagagaggc
tattgtagcgacgtgacacgcgtgacgtggtatccagccggtagtggaccaagagaatgg
cgtgagctcgttgagcgtgtcgtggctgcagtgggtgaggctatagaccgtgtagaaccg
ggtatcgaggctagtgtagtggacgaggttgctaggagagcgctgggaccatatgcaaaa
tggttcatacactcaaccggtcacggtataggcgtagaggtccacgagccgcctagggtg
gcgccaggggagaaaaccaggctcgaaaagggcatggtgttcacgatagagcctggggtg
tatcttagaggacggtttggtgttaggatagagcagatggttgttgtcgactccaggggc
gcccgtgtgctaaacaagctgcccatgactctagagtag

DBGET integrated database retrieval system