KEGG   Pyrolobus fumarii: Pyrfu_0027Help
Entry
Pyrfu_0027        CDS       T01620                                 

Definition
(GenBank) hypothetical protein
  KO
K06984  beta-ribofuranosylaminobenzene 5'-phosphate synthase [EC:2.4.2.54]
Organism
pfm  Pyrolobus fumarii
Pathway
pfm00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:pfm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pyrfu_0027
Enzymes [BR:pfm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.54  beta-ribofuranosylphenol 5'-phosphate synthase
     Pyrfu_0027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C NfeD PPR_1 GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AEM37899
UniProt: G0EDY3
Position
complement(21434..22432)
Genome map
AA seq 332 aa AA seqDB search
MSGVCYTISVPSHVHAGNYEFTCDESVHRCFGTVGVALSNPRLVVKICKSNDIRVHSVNG
DRWCRELENIARGYAQRVYEITGVRVTVELRKCYPWGAGLGARTALALAVADAALRLGSE
GVTLEDVALELGRGWVSALGFYTYTRGGLVVDAGFEPDLIGAAIPPLVARYEPPIEIVVV
LPLRPLGVVRRLKEQEEDVDKLAKPDAPPELSAKLARLLLTGFMGNLAAGRLDRAFRALS
EMNREAGRYWAGKGQGGTYCCRETEEAIRFLERMGAVGVFQSSWGPAAWGVFTDAALARR
AARKAIMLSERIGEVSVWHAHVDTQGAIVKPG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttgagcggcgtttgctacacgatatcagttccatcgcacgtgcacgcgggtaactacgag
ttcacttgtgatgagagtgttcacaggtgttttggaaccgttggggtcgctctgagcaat
ccacggcttgtagtcaaaatctgcaagtccaacgatattagagtccatagcgtcaatggt
gacagatggtgcagagagctagagaacattgcacgcgggtatgcgcaacgtgtatacgag
attacgggtgttagagttactgtcgagctgcggaagtgttacccctggggggcgggtcta
ggtgctcgcacggctctagccctagctgtggcagacgcggccctacgcttgggcagcgag
ggtgtaacccttgaagatgtggctctcgagcttggaaggggatgggtttctgcactaggc
ttctatacgtacacgcgtgggggtctagtagtcgatgcgggtttcgagcccgaccttata
ggcgcggctatcccgcccctagtggcccgctacgaaccgccaatagagatagtagtggtg
ctcccattgaggcctcttggtgtggtaaggcggctaaaagagcaggaagaagatgtggat
aagcttgcaaaaccagatgcgccgcccgagctgtcagcaaagctcgcaaggctgttgcta
acagggttcatggggaacctcgcagccgggaggctagaccgtgctttccgtgctctctcc
gagatgaaccgcgaggccggccgctattgggctggtaaaggccagggcggcacctattgc
tgcagggagaccgaggaggcgatacgtttccttgagagaatgggggccgtcggtgtattc
cagagtagctgggggccggctgcctggggtgtattcacggacgctgctctagcgaggcgt
gcagccaggaaggctatcatgctcagcgagcggataggagaggtaagtgtgtggcacgcg
catgtagacacgcagggtgccatagttaaacctggttaa

DBGET integrated database retrieval system