KEGG   Pyrolobus fumarii: Pyrfu_0037Help
Entry
Pyrfu_0037        CDS       T01620                                 

Definition
(GenBank) Radical SAM domain protein
  KO
K06935  uncharacterized protein
Organism
pfm  Pyrolobus fumarii
Brite
KEGG Orthology (KO) [BR:pfm00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Pyrfu_0037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_14
Motif
Other DBs
NCBI-ProteinID: AEM37909
UniProt: G0EDZ3
Position
complement(32623..33705)
Genome map
AA seq 360 aa AA seqDB search
MKDVEKGRKEGVPGVEGVVVDGRVWGKPLVRLSRPAPLMGTVFIGVIDRGTNVLQVRPTT
LCNLSCIFCSVDAGPSSRWRQAEFIIDDVEWLVTWVEEIARYKGVRVEALIDGVGEPTTY
PRLVELIRRLKESPWVESVALETHGQSLDERVVREWERAGLDRINLSIDTLDAMKAKMLT
GVEWYDLERVKKLAEFIARETRIDLHVTPVWIPGVNDEDVPQVVKWAVEIGAGKRWPPAT
VQKFLEHRHGRKPPGVREIPWNVFWRRLREWSRELGVNLIPSMEEWGMRYARKVPEIYRE
GDVIRVVLVAPGWLKREVLAVSADSKRLVTVVGLKRWNPGDEIDVVVLRSKDNIYVARPA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggacgtggagaagggtagaaaggagggagtgcctggagtagaaggagttgtcgtt
gatggccgtgtgtgggggaaaccacttgtacgcctctctagaccagcgcccctcatgggc
acggtattcataggcgtgatagataggggtaccaatgttctccaagtgaggccaaccacg
ctttgcaacctgtcctgcatattctgtagtgttgatgcggggcctagtagtagatggaga
caagcagagttcataatcgatgatgttgagtggcttgtcacgtgggttgaggaaattgct
cgttataagggtgtgcgtgtagaggcgttgatagacggtgtcggcgagccgacgacgtac
ccgaggcttgtcgagctaataaggaggcttaaggagagcccgtgggttgagagcgtagct
cttgagacgcatggtcagagtctggatgagcgggtggtgcgtgagtgggagcgtgcaggc
ctggaccgtatcaacttgagtatagacacgcttgatgccatgaaagctaagatgctgacc
ggagtggaatggtacgatttagagcgggtcaaaaagctggcagagttcatagccagagag
acgagaatagaccttcacgttactcccgtgtggataccgggagttaatgatgaagatgtg
ccgcaggtggtgaagtgggctgtcgagataggtgccggtaagagatggccccccgcaact
gtgcagaagttcctagagcatcgccacggtaggaaaccgccgggtgtccgcgagatacca
tggaacgtgttttggagaagactgcgagagtggagccgggaactcggtgtgaaccttatc
cccagcatggaggaatggggtatgaggtatgcgaggaaggtcccagagatctaccgtgaa
ggtgacgtcatacgcgtggttctcgttgcaccgggatggttgaagagggaggttctagct
gtgagcgctgatagtaagaggcttgtgactgtagtggggttgaaacggtggaatccgggc
gatgagatagacgttgtagtactgcggagcaaggacaacatatacgtggcgaggccggcg
tga

DBGET integrated database retrieval system