KEGG   Pyrolobus fumarii: Pyrfu_0039Help
Entry
Pyrfu_0039        CDS       T01620                                 

Definition
(GenBank) hypothetical protein
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4941
Motif
Other DBs
NCBI-ProteinID: AEM37911
UniProt: G0EDZ5
Position
complement(34641..34898)
Genome map
AA seq 85 aa AA seqDB search
MAVSDYLKQLRDILKEKLQRDDISIIVIGSTMKISKSGQTIMTLQDKGQIVELNFQGKKY
TYDKWYTKPPHLAQTILNVFQYQNL
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
gtggctgtgagcgactacctcaaacagcttagagacatcctcaaggagaagctccagagg
gacgacataagcataatcgtgatcggctcgaccatgaagatttcgaagagcggtcagact
ataatgacgttgcaggataagggccagatagtagagctaaacttccagggcaagaagtac
acctacgacaagtggtacaccaagccgccgcatctagcacaaaccatactgaacgtcttc
cagtaccagaacttgtaa

DBGET integrated database retrieval system