KEGG   Pyrolobus fumarii: Pyrfu_0040Help
Entry
Pyrfu_0040        CDS       T01620                                 

Definition
(GenBank) hypothetical protein
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHHA1
Motif
Other DBs
NCBI-ProteinID: AEM37912
UniProt: G0EDZ6
Position
complement(34938..35891)
Genome map
AA seq 317 aa AA seqDB search
MRTSLEKVRRLYIVFHGDLDGVVGAALLARWASDRGARWEAHHSTVRGLPRVLRNVVNKA
KSMLGKPGIALVDLAVQSMGDAIIYANLLKGMPSAWFDHHPWPSGAAERLLNVGVEVYHL
RDYVSAELVARTLGLNDEYSAKLVRIARADDTCEPGESEADKWRIVLRALRDPVKAVEAF
ARGDLWPDWAQQLYEEHVERYMSEAERVAARLRVYEYNGVKVAVIPMEPGVDVCTIQKLL
WSRGWNPENIDVEVYVYPRAISLRSVKLDVSCIAKALGGGGHKRAAGAPRPSQLMGEAQI
ARLVASQVEKCLGEATH
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttgaggacgagcctagagaaggttagacgcctctacatagtatttcacggggacctcgac
ggtgttgttggtgccgcgcttctagcccgctgggcatccgaccggggtgcacgctgggaa
gcacaccactctactgtccgcggtctaccacgagtcctccgcaacgtagtcaacaaggca
aagtcgatgttaggtaagcctggtatcgcgttagtagaccttgctgtccagtcgatggga
gacgctataatctatgctaacttgttgaagggtatgcctagcgcttggttcgaccaccat
ccgtggccgtcaggtgccgccgagaggctcctaaacgtcggcgtagaggtgtaccatcta
cgcgattacgtgtctgcagagctcgtggcgcgcacgttagggcttaacgacgagtatagc
gccaagctagtcaggatagcgagagccgatgatacatgcgagcctggtgaaagcgaagcc
gacaagtggagaatcgtcctgagggctcttcgcgacccagtgaaagctgtcgaggctttt
gctagaggtgacttgtggcccgactgggctcaacagctctacgaggagcatgtagagcgt
tacatgagtgaagctgagcgtgtcgctgcgaggctacgcgtatacgaatacaatggtgtt
aaggtggcagttatcccgatggaacccggtgtcgacgtctgcaccatacagaagctgttg
tggagtcgtggctggaaccccgagaacatagacgtagaggtgtacgtctatccgcgtgcc
attagcttgagaagcgtcaaactcgacgtctcgtgtatagctaaggcgcttggcggtgga
ggccacaagcgggcagccggtgcgcctagaccgtctcagcttatgggtgaggctcagata
gcgaggctcgttgcctcgcaagtcgaaaagtgtcttggcgaggcaacccactag

DBGET integrated database retrieval system