KEGG   Pyrolobus fumarii: Pyrfu_0043Help
Entry
Pyrfu_0043        CDS       T01620                                 

Definition
(GenBank) dephospho-CoA kinase, CoaE
Organism
pfm  Pyrolobus fumarii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_17 AAA_18 AAA_33 AAA_16 AAA NTPase_1 Zeta_toxin ADK CoaE PGM_PMM_II
Motif
Other DBs
NCBI-ProteinID: AEM37915
UniProt: G0EDZ9
Position
36755..37312
Genome map
AA seq 185 aa AA seqDB search
MGLRFVLIAGMPGAGKSIVARVARELGLPVFTMGDVVREEVRRRGLEPTPANMNKVATEL
RKLYGKTVIAERTLDAIKKSGIRDGIIVIDGVRSLEEVDVFSSYAPVTIVAVHASPKTRF
ERLRARGRPGDPRTWEEFRARDLMELGFGLGNVIALADYMLVNDGVTLDEFVSQAKRLLE
AMIRG
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttggggttacgtttcgtgctcatagctggcatgcccggtgcaggcaagagcatcgtagcc
agagttgctagggaacttggcttgccggtcttcactatgggtgatgttgtcagagaggag
gttagaaggaggggtttggagccaacacccgccaatatgaacaaggtggctacagagctg
cgcaagctgtacggaaagactgtcatagccgagaggaccctagacgctatcaagaagagc
ggcatccgggatggcattatagtgatagacggtgttcgtagcctagaggaggtcgacgtg
tttagcagttatgcgccagtgactatagtagctgtccatgcttcaccaaaaactcgattc
gagcgtctacgcgcccgtggtcgccctggcgatccacgcacatgggaggagttcagagca
cgcgatctgatggagctaggattcggccttggtaatgtgatagcactcgccgactacatg
ctagtgaatgatggcgtgacgctggacgaattcgtgtcgcaagccaaacgcctcttagaa
gctatgataagggggtag

DBGET integrated database retrieval system